CB250274

Overview
NameCB250274
Unique NameCB250274
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length375
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CB250274_ssr172 microsatellite CB250274_ssr172:172..183. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of CB250274 vs. ExPASy Swiss-Prot
Match: PR4A_TOBAC (Pathogenesis-related protein PR-4A OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 6.878e-12
Identity = 30/37 (81.08%), Postives = 33/37 (89.19%), Query Frame = 1
Query:    1 NGGLDLDEGVFKKLDTNGIGYQQGFLTVSYEFVNCND 111
            NGGLDLD  VF +LDTNG+GYQQG LTV+YEFVNCND
Sbjct:  111 NGGLDLDVNVFNQLDTNGVGYQQGHLTVNYEFVNCND 147          
BLAST of CB250274 vs. ExPASy Swiss-Prot
Match: PR4B_TOBAC (Pathogenesis-related protein PR-4B OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 4.458e-11
Identity = 29/37 (78.38%), Postives = 32/37 (86.49%), Query Frame = 1
Query:    1 NGGLDLDEGVFKKLDTNGIGYQQGFLTVSYEFVNCND 111
            NGGLDLD  VF +LDTNG+GYQQG L V+YEFVNCND
Sbjct:  111 NGGLDLDVNVFNQLDTNGLGYQQGHLIVNYEFVNCND 147          
The following BLAST results are available for this feature:
BLAST of CB250274 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
PR4A_TOBAC6.878e-1281.08Pathogenesis-related protein PR-4A OS=Nicotiana ta... [more]
PR4B_TOBAC4.458e-1178.38Pathogenesis-related protein PR-4B OS=Nicotiana ta... [more]
back to top
Properties
Property NameValue
Genbank descriptionEST0046 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ060 similar to pathogenesis-related protein 4A (acc# S23799), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250274 ID=CB250274|Name=CB250274|organism=Citrus sinensis|type=EST|length=375bp
AATGGAGGCTTAGATTTGGACGAAGGAGTGTTCAAGAAATTGGACACCAA
TGGAATAGGCTATCAACAAGGCTTCCTTACTGTCAGCTACGAGTTTGTGA
ACTGCAATGATTAGAGCACCATCTATAATTCCATGATCGATCGAAGCTTA
TTGCTGTAATAGGGTTAATTTATTAATTAATTATCCCTCTATATATTTAG
TTCATAAATAAAATAAACTTCTGATGAAGTATCAAGAAGTGCTCATGGGC
ACTACAGTTATGTAATAAAAGTTTCCTTTTTTTATCCCTTTACATTTTCT
TGAATTTAAATACCTTTAGTCGATTAAAAAATATTGTATAAAAAGTTACT
CCTGAACAAAAAAAAAAAAAAAAAA
back to top