CB250296

Overview
NameCB250296
Unique NameCB250296
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length812
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CB250296_ssr73 microsatellite CB250296_ssr73:73..84. BLAST: Citrus ESTs to Prunus persica proteins V1
Homology
BLAST of CB250296 vs. ExPASy Swiss-Prot
Match: STAG1_MOUSE (Cohesin subunit SA-1 OS=Mus musculus GN=Stag1 PE=1 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 1.156e-12
Identity = 58/209 (27.75%), Postives = 96/209 (45.93%), Query Frame = 3
Query:   12 MKDWKCIISMLLDENPLID--LNDDDATNLIRLLSASVKKAVGERIVPASDNRKPYYNKAQKEVFENNKREITRAMMKNYPRLLRKFMADKAKVPSLIDIVMHMKLELYSLKRDEKSFETILQLVNDAFFKHGEKEALRSCVKAIK-FCSAESQGELQ-DSARKNLKD---------VEDXXXXXXXXXXXXVLDGDDEYSLLVNLKRL 599
            +KDW+C+  +LL+E    +  ++D   + LI L+  ++++A            K      +++   +++ ++T   +   P LL K+ AD  KV +L+ I  +  LE+YS  R EK  + +L+ +     KH E + L +C K     CS E   + + D AR  L D         VED              D DD Y++L  LKRL
Sbjct:  496 LKDWECMTELLLEEPVQGEEAMSDRQESALIELMVCTIRQAAEAHPPVGRGTGKRVLTAKERKTQIDDRNKLTEHFIITLPMLLSKYSADAEKVANLLQIPQYFDLEIYSTGRMEKHLDALLKQIKFVVEKHVESDVLEACSKTYSILCSEEYTIQNRVDIARSQLIDEFVDRFNHSVEDLLQEGEE------ADDDDIYNVLSTLKRL 698          
BLAST of CB250296 vs. ExPASy Swiss-Prot
Match: STAG1_HUMAN (Cohesin subunit SA-1 OS=Homo sapiens GN=STAG1 PE=1 SV=3)

HSP 1 Score: 73.9442 bits (180), Expect = 1.156e-12
Identity = 58/209 (27.75%), Postives = 96/209 (45.93%), Query Frame = 3
Query:   12 MKDWKCIISMLLDENPLID--LNDDDATNLIRLLSASVKKAVGERIVPASDNRKPYYNKAQKEVFENNKREITRAMMKNYPRLLRKFMADKAKVPSLIDIVMHMKLELYSLKRDEKSFETILQLVNDAFFKHGEKEALRSCVKAIK-FCSAESQGELQ-DSARKNLKD---------VEDXXXXXXXXXXXXVLDGDDEYSLLVNLKRL 599
            +KDW+C+  +LL+E    +  ++D   + LI L+  ++++A            K      +++   +++ ++T   +   P LL K+ AD  KV +L+ I  +  LE+YS  R EK  + +L+ +     KH E + L +C K     CS E   + + D AR  L D         VED              D DD Y++L  LKRL
Sbjct:  496 LKDWECMTELLLEEPVQGEEAMSDRQESALIELMVCTIRQAAEAHPPVGRGTGKRVLTAKERKTQIDDRNKLTEHFIITLPMLLSKYSADAEKVANLLQIPQYFDLEIYSTGRMEKHLDALLKQIKFVVEKHVESDVLEACSKTYSILCSEEYTIQNRVDIARSQLIDEFVDRFNHSVEDLLQEGEE------ADDDDIYNVLSTLKRL 698          
BLAST of CB250296 vs. ExPASy Swiss-Prot
Match: STAG2_XENLA (Cohesin subunit SA-2 OS=Xenopus laevis GN=stag2 PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.972e-12
Identity = 55/212 (25.94%), Postives = 92/212 (43.40%), Query Frame = 3
Query:   12 MKDWKCIISMLLDE--NPLIDLNDDDATNLIRLLSASVKKAVGERIVPASDNRKPYYNKAQKEVFENNKREITRAMMKNYPRLLRKFMADKAKVPSLIDIVMHMKLELYSLKRDEKSFETILQLVNDAFFKHGEKEALRSCVKA--------------IKFCSAESQGELQDSARKNLKDVEDXXXXXXXXXXXXVLDGDDEYSLLVNLKRL 599
            +KDW C+ S+LLD+  N    L D   + LI +L  +V++A            K      +K+   ++K  +T     + P+LL K+  D  KV +L+ +  +  LE+Y+  R EK  E +L+ + +   KH + + L +C K               +    ++   EL D   + L+D                LD DD Y +L  LKR+
Sbjct:  423 LKDWDCMNSLLLDDPLNGEEALTDRQESALIEILLCTVRQAAECHPPVGRGTGKRVLTAKEKKSQMDDKTHLTELFAVSLPQLLAKYSVDAEKVTNLLQLPQYFDLEIYTTGRLEKHLEALLRQIRNIVEKHTDTDVLEACSKTYHALCNEEFTIYNRVDIAKSQLIDELADKFNRLLED---------FLQEEEELDEDDAYQVLSTLKRI 625          
BLAST of CB250296 vs. ExPASy Swiss-Prot
Match: STAG3_HUMAN (Cohesin subunit SA-3 OS=Homo sapiens GN=STAG3 PE=1 SV=2)

HSP 1 Score: 70.0922 bits (170), Expect = 1.669e-11
Identity = 63/223 (28.25%), Postives = 102/223 (45.74%), Query Frame = 3
Query:   12 MKDWKCIISMLLDENPLIDLNDDDATNLIRLLSASVKKAV-GERIVPASDNRKPYYNKAQKEVFENNKREITRAMMKNYPRLLRKFMADKAKVPSLIDIVMHMKLELYSLKRDEKSFETILQLVNDAFFKHGEKEALRSCVKAIKF-CSAE-SQGELQDSARKNLKDV--EDXXXXXXXXXXXXVLDGDDEYSLLVNLKRLYELQLSKAVPIESLYEDLVMIL 665
            +KDW+ + S+LL+++   +L D   + LI +L +S ++A  G   V     RK   +K +K   ++  + +T  ++   P+LL KF AD  KV  L+ ++    L +Y   R EK  E  LQ + +   KH E   L +   A+   C+ E +     D AR  L D+  +              LD D+ Y+L   LKRL     +  +    LYE    +L
Sbjct:  509 LKDWEGLTSLLLEKDQ--NLGDVQESTLIEILVSSARQASEGHPPVGRVTGRKGLTSKERKTQADDRVK-LTEHLIPLLPQLLAKFSADAEKVTPLLQLLSCFDLHIYCTGRLEKHLELFLQQLQEVVVKHAEPAVLEAGAHALYLLCNPEFTFFSRADFARSQLVDLLTDRFQQELEELLQSSFLDEDEVYNLAATLKRLSAFYNTHDLTRWELYEPCCQLL 728          
BLAST of CB250296 vs. ExPASy Swiss-Prot
Match: STAG1_XENLA (Cohesin subunit SA-1 OS=Xenopus laevis GN=stag1 PE=1 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 2.847e-11
Identity = 48/203 (23.65%), Postives = 98/203 (48.28%), Query Frame = 3
Query:   12 MKDWKCIISMLLDENPLID--LNDDDATNLIRLLSASVKKAVGERIVPASDNRKPYYNKAQKEVFENNKREITRAMMKNYPRLLRKFMADKAKVPSLIDIVMHMKLELYSLKRDEKSFETILQLVNDAFFKHGEKEALRSCVKAIK-FCSAE--SQGELQDSARKNLKDVEDXXXXXXXXXXXXVLDGDDE--YSLLVNLKRL 599
            +KDW+C+  +L++E    +  +++   + L+ L+  ++++A            K      +++   ++K ++T   +   P LL K+ AD  KV +L+ I  +  LELYS  R EK  +++L+ +     KH E + L +C K     CS E   Q  ++ +  + + ++ D              + D++  Y+++ +LKRL
Sbjct:  503 LKDWECMTELLVEEPMQGEEVMSERQESALVELMVCTIRQAAEAHPPVGRGTGKRVLTAKERKTQLDDKTKLTEHFIVALPVLLSKYSADAEKVANLLQIPQYFDLELYSTGRMEKHLDSLLKQIRFVVEKHIESDVLEACSKTYSILCSEEYTIQNRVEIAHSQLIDELADRFSHAVEELLQEAEEADEDEIYNVMASLKRL 705          
BLAST of CB250296 vs. ExPASy Swiss-Prot
Match: STAG3_RAT (Cohesin subunit SA-3 OS=Rattus norvegicus GN=Stag3 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 4.856e-11
Identity = 55/200 (27.50%), Postives = 91/200 (45.50%), Query Frame = 3
Query:   12 MKDWKCIISMLLDENPLIDLNDDDATNLIRLLSASVKKAVGERIVPASDNRKPYYNKAQKEVFENNKREITRAMMKNYPRLLRKFMADKAKVPSLIDIVMHMKLELYSLKRDEKSFETILQLVNDAFFKHGEKEALRSCVKAIKF-CSAE-SQGELQDSARKNLKDV--EDXXXXXXXXXXXXVLDGDDEYSLLVNLKRL 599
            +KDW+ + S+LL ++   +L D     LI +L +S ++A            K      ++++   +K ++   ++   P+LL KF AD   V  L+ ++ +  L +Y  +R EK  E +LQ + +   KH E E L +   A+   C  E +     D AR  L D+  +              LD D+ YSL   LKRL
Sbjct:  524 LKDWESLTSLLLQKDQ--NLGDMQERMLIEILVSSARQAAEGHPPVGRITGKKSLTAKERKLQAYDKVKLAEHLIPLLPQLLAKFSADAENVAPLLRLLSYFDLNIYCTQRLEKHLELLLQQLQEVVVKHVEPEVLEAAAHALYLLCKPEFTFFSRVDFARSQLVDLLTDRFQQELDDLMQSSFLDEDEVYSLTATLKRL 721          
BLAST of CB250296 vs. ExPASy Swiss-Prot
Match: STAG2_HUMAN (Cohesin subunit SA-2 OS=Homo sapiens GN=STAG2 PE=1 SV=3)

HSP 1 Score: 68.5514 bits (166), Expect = 4.856e-11
Identity = 56/210 (26.67%), Postives = 97/210 (46.19%), Query Frame = 3
Query:   12 MKDWKCIISMLLDENPLID---LNDDDATNLIRLLSASVKKAVGERIVPASDNRKPYYNKAQKEVFENNKREITRAMMKNYPRLLRKFMADKAKVPSLIDIVMHMKLELYSLKRDEKSFETILQLVNDAFFKHGEKEALRSCVKAI-KFCSAE---------SQGELQDS-ARKNLKDVEDXXXXXXXXXXXXVLDGDDEYSLLVNLKRL 599
            +KDW+C+ S+LL+E PL     L D   + LI ++  ++++A            K      +K+   +++ +IT       P+LL K+  D  KV +L+ +  +  LE+Y+  R EK  + +L+ + +   KH + + L +C K     C+ E         S+ +L D  A K  + +ED              D DD Y +L  LKR+
Sbjct:  492 LKDWECMNSLLLEE-PLSGEEALTDRQESALIEIMLCTIRQAAECHPPVGRGTGKRVLTAKEKKTQLDDRTKITELFAVALPQLLAKYSVDAEKVTNLLQLPQYFDLEIYTTGRLEKHLDALLRQIRNIVEKHTDTDVLEACSKTYHALCNEEFTIFNRVDISRSQLIDELADKFNRLLEDFLQEGEEP------DEDDAYQVLSTLKRI 694          
The following BLAST results are available for this feature:
BLAST of CB250296 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
STAG1_MOUSE1.156e-1227.75Cohesin subunit SA-1 OS=Mus musculus GN=Stag1 PE=1... [more]
STAG1_HUMAN1.156e-1227.75Cohesin subunit SA-1 OS=Homo sapiens GN=STAG1 PE=1... [more]
STAG2_XENLA1.972e-1225.94Cohesin subunit SA-2 OS=Xenopus laevis GN=stag2 PE... [more]
STAG3_HUMAN1.669e-1128.25Cohesin subunit SA-3 OS=Homo sapiens GN=STAG3 PE=1... [more]
STAG1_XENLA2.847e-1123.65Cohesin subunit SA-1 OS=Xenopus laevis GN=stag1 PE... [more]
STAG3_RAT4.856e-1127.50Cohesin subunit SA-3 OS=Rattus norvegicus GN=Stag3... [more]
STAG2_HUMAN4.856e-1126.67Cohesin subunit SA-2 OS=Homo sapiens GN=STAG2 PE=1... [more]
back to top
Properties
Property NameValue
Genbank descriptionEST0075 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ101 similar to putative sister-chromatide cohesion protein (acc# NP_566119), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250296 ID=CB250296|Name=CB250296|organism=Citrus sinensis|type=EST|length=812bp
ACATGAAGGCCATGAAGGATTGGAAGTGTATAATCTCCATGCTTTTGGAT
GAGAATCCATTGATTGATCTTAATGATGATGATGCAACGAACTTGATCAG
ACTACTCTCTGCATCTGTCAAAAAGGCCGTTGGAGAGAGGATTGTTCCTG
CTTCCGACAACCGAAAGCCTTATTACAATAAGGCTCAAAAAGAAGTATTT
GAAAACAACAAACGGGAGATAACTCGTGCCATGATGAAGAACTATCCTCG
TCTATTACGCAAATTTATGGCTGACAAGGCAAAAGTGCCATCATTAATAG
ACATTGTCATGCACATGAAGCTTGAGCTTTATTCCCTAAAGCGAGATGAG
AAGAGTTTTGAAACCATCCTTCAGCTTGTCAACGACGCATTTTTTAAGCA
TGGTGAAAAGGAGGCACTACGATCTTGTGTAAAAGCTATTAAGTTTTGTT
CCGCGGAAAGTCAAGGAGAGCTGCAAGATTCTGCACGCAAGAACTTAAAG
GATGTTGAAGATAAGCTTATTGCTAAGCTTAAATCTGCTATTAAAGCAGT
TTTGGATGGCGATGATGAATATTCTCTTCTTGTAAATTTGAAAAGATTGT
ATGAGCTTCAGTTGTCAAAGGCTGTGCCAATCGAGAGCTTGTATGAAGAT
CTTGTCATGATTCTCCATACTTTCAGAAACTTGGATAATGAGGTGGTCAG
TTTTCTGCTCCTCAATTTGTATTTATATCTAGCATGGTCTCTGCACTCTA
TTATAAATGCTGAAACTGTCTCTGAAGCATCCTTAGCTTCTCTCCTGCTA
AAGCGCAATACT
back to top