CB250299

Overview
NameCB250299
Unique NameCB250299
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length404
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB250299 vs. ExPASy Swiss-Prot
Match: SPG1_SCHPO (Septum-promoting GTP-binding protein 1 OS=Schizosaccharomyces pombe GN=spg1 PE=1 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 3.631e-21
Identity = 48/102 (47.06%), Postives = 67/102 (65.69%), Query Frame = 3
Query:  102 DTDSDLVSLKISLLGDCQIGKTSFVVKYV-GNEQERSLQMAGLNLINKTLMVQGARIAFSIWDVGGDSRSFDHVPIACKDAVAILFMFDLTSRCTLNSIVGW 404
            D   + V++K+ ++GD  IGKTS +V YV G+  E S Q  G+N + KT+ ++   I FSIWD+GG     + +P+ C DAVAILFMFDL+ + TLNSI  W
Sbjct:    3 DARKNNVTIKVGMIGDSSIGKTSLMVTYVQGSFDEESTQTLGVNFMEKTISIRNTEITFSIWDLGGQREFVNMLPMVCNDAVAILFMFDLSRKSTLNSIKEW 104          
BLAST of CB250299 vs. ExPASy Swiss-Prot
Match: TEM1_YEAST (Protein TEM1 OS=Saccharomyces cerevisiae GN=TEM1 PE=1 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 1.633e-13
Identity = 38/96 (39.58%), Postives = 59/96 (61.46%), Query Frame = 3
Query:  120 VSLKISLLGDCQIGKTSFVVKYVGNEQERSL-QMAGLNLINKTLMVQGARIAFSIWDVGGDSRSFDHVPIACKDAVAILFMFDLTSRCTLNSIVGW 404
            V +++ L+GD Q+GKTS +VKYV N  ++   Q  G+N + + + ++   I FSI D+GG     + +PIA   +  I+F+FDLT   TL+SI  W
Sbjct:   19 VEVQVGLVGDAQVGKTSLMVKYVQNIYDKEYTQTLGVNFLKRKVSIRSTDIIFSIMDLGGQREFINMLPIATVGSSVIIFLFDLTRPETLSSIKEW 114          
BLAST of CB250299 vs. ExPASy Swiss-Prot
Match: RAB26_DROME (Ras-related protein Rab-26 OS=Drosophila melanogaster GN=Rab26 PE=1 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 1.997e-11
Identity = 38/99 (38.38%), Postives = 54/99 (54.55%), Query Frame = 3
Query:  114 DLVSLKISLLGDCQIGKTSFVVKYVGNEQERSLQMA--GLNLINKTLMVQGARIAFSIWDVGGDSRSFDHVPIACKDAVAILFMFDLTSRCTLNSIVGW 404
            D V+ K  LLGD  +GKTSF+VKY   E       A  G+ L NK ++V G R+   IWD  G  R         +DA A+L ++D+T++ T ++I  W
Sbjct:  187 DTVNHKTILLGDSGVGKTSFLVKYNTGEFRLGSFSATVGIALTNKVVVVDGTRVKLQIWDTAGQERFRSVTHAYYRDAHALLLLYDVTNKTTYDNIRAW 285          
The following BLAST results are available for this feature:
BLAST of CB250299 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
SPG1_SCHPO3.631e-2147.06Septum-promoting GTP-binding protein 1 OS=Schizosa... [more]
TEM1_YEAST1.633e-1339.58Protein TEM1 OS=Saccharomyces cerevisiae GN=TEM1 P... [more]
RAB26_DROME1.997e-1138.38Ras-related protein Rab-26 OS=Drosophila melanogas... [more]
back to top
Properties
Property NameValue
Genbank descriptionEST0078 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ106 similar to SPG1 monomeric G-protein (acc# NP_200295), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250299 ID=CB250299|Name=CB250299|organism=Citrus sinensis|type=EST|length=404bp
TCCAGAAGTTGACCCGCCGGTCGTCGTCGGAGTCTTCTCCGGCGCCGGAT
ACTATGGAGGCCGGCCTTGTGGAGCTTTCCAGGACGTTTAGTAGTGGGTA
TGATACGGATTCGGACTTGGTTTCTTTGAAGATCAGTTTGTTGGGTGATT
GCCAAATTGGCAAAACAAGCTTCGTGGTCAAGTATGTGGGAAATGAGCAA
GAAAGAAGCTTGCAAATGGCAGGATTGAATCTGATAAATAAAACTTTGAT
GGTTCAAGGTGCCAGAATTGCTTTTAGCATCTGGGATGTTGGAGGAGATA
GCAGGTCATTTGATCATGTTCCAATTGCTTGTAAAGATGCAGTAGCAATT
TTATTCATGTTTGATCTTACTAGCAGATGCACCCTTAACAGTATTGTTGG
GTGG
back to top