CB250303

Overview
NameCB250303
Unique NameCB250303
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length631
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CB250303_ssr31 microsatellite CB250303_ssr31:31..42. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig1944 contig Csv1_Contig1944:349..979. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB250303 vs. ExPASy Swiss-Prot
Match: PSBQ2_ARATH (Oxygen-evolving enhancer protein 3-2, chloroplastic OS=Arabidopsis thaliana GN=PSBQ2 PE=1 SV=2)

HSP 1 Score: 192.2 bits (487), Expect = 1.865e-48
Identity = 97/149 (65.10%), Postives = 115/149 (77.18%), Query Frame = 2
Query:    5 ADATPIKVXXXXXXXXXXXXTLNSDEPRDLDLPLKERFFIQPLSPXXXXXXXXXXXKDILNVKELIDKKAWPYVQNDLRLRASYLRYDLNTIISAKPKDEKQSLKNLTGKLFQTIGNLDHAAKIKSTPEAEKYYAETVSTLNDVLSKVG 451
            A+A PIKV            T NSD+ RD  L LK+RF+IQPLSP           K+I+NVK  IDKKAWPYVQNDLRLRASYLRYDLNT+ISAKPK+EKQSLK+LT KLFQTI NLD+AA+ KS+P+AEKYY+ETVS+LN+VL+K+G
Sbjct:   82 AEAIPIKVGGPPLPSGGLPGTDNSDQARDFSLALKDRFYIQPLSPTEAAARAKDSAKEIINVKSFIDKKAWPYVQNDLRLRASYLRYDLNTVISAKPKEEKQSLKDLTAKLFQTIDNLDYAARSKSSPDAEKYYSETVSSLNNVLAKLG 230          
BLAST of CB250303 vs. ExPASy Swiss-Prot
Match: PSBQ1_MAIZE (Oxygen-evolving enhancer protein 3-1, chloroplastic OS=Zea mays GN=PSBQ1 PE=2 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 1.745e-46
Identity = 90/129 (69.77%), Postives = 105/129 (81.40%), Query Frame = 2
Query:   65 TLNSDEPRDLDLPLKERFFIQPLSPXXXXXXXXXXXKDILNVKELIDKKAWPYVQNDLRLRASYLRYDLNTIISAKPKDEKQSLKNLTGKLFQTIGNLDHAAKIKSTPEAEKYYAETVSTLNDVLSKVG 451
            TLNSD+ RD DLPLKERF++QPL P           +DI+N+K LIDKKAWPYVQNDLRLRASYLRYDL T+I++KPK+EK+SLK LTGKLF TI +LDHAAKIKSTPEAEKY+A T   L DVL+K+G
Sbjct:   89 TLNSDQARDFDLPLKERFYLQPLPPAEAAARVKTSAQDIINLKPLIDKKAWPYVQNDLRLRASYLRYDLKTVIASKPKEEKKSLKELTGKLFSTIDDLDHAAKIKSTPEAEKYFAATKDALGDVLAKLG 217          
BLAST of CB250303 vs. ExPASy Swiss-Prot
Match: PSBQ2_MAIZE (Oxygen-evolving enhancer protein 3-2, chloroplastic OS=Zea mays GN=PSBQ2 PE=3 SV=1)

HSP 1 Score: 184.496 bits (467), Expect = 3.888e-46
Identity = 89/129 (68.99%), Postives = 105/129 (81.40%), Query Frame = 2
Query:   65 TLNSDEPRDLDLPLKERFFIQPLSPXXXXXXXXXXXKDILNVKELIDKKAWPYVQNDLRLRASYLRYDLNTIISAKPKDEKQSLKNLTGKLFQTIGNLDHAAKIKSTPEAEKYYAETVSTLNDVLSKVG 451
            TLNSD+ RD DLPLKERF++QPL P           +DI+N+K LIDKKAWPYVQNDLRLRASYLRYDL T+I++KPK+EK+SLK LTGKLF TI +LDHAAK+KSTPEAEKY+A T   L DVL+K+G
Sbjct:   85 TLNSDQTRDFDLPLKERFYLQPLPPAEAVARVKTSAQDIINLKPLIDKKAWPYVQNDLRLRASYLRYDLKTVIASKPKEEKKSLKELTGKLFSTIDDLDHAAKMKSTPEAEKYFAATKDALGDVLAKLG 213          
BLAST of CB250303 vs. ExPASy Swiss-Prot
Match: PSBQ1_ARATH (Oxygen-evolving enhancer protein 3-1, chloroplastic OS=Arabidopsis thaliana GN=PSBQ1 PE=1 SV=3)

HSP 1 Score: 176.792 bits (447), Expect = 8.107e-44
Identity = 95/151 (62.91%), Postives = 110/151 (72.85%), Query Frame = 2
Query:    2 LADATPIKVXXXXXXXXXXXX-TLNSDEPRDLDLPLKERFFIQPLSPXXXXXXXXXXXKDILNVKELIDKKAWPYVQNDLRLRASYLRYDLNTIISAKPKDEKQSLKNLTGKLFQTIGNLDHAAKIKSTPEAEKYYAETVSTLNDVLSKVG 451
            LADA  IKV             T NSD+ RD  L LK+RF++QPL P           KDI+NVK LID+KAWPYVQNDLR +ASYLRYDLNTIIS+KPKDEK+SLK+LT KLF TI NLD+AAK KS  +AEKYYAETVS LN+VL+K+G
Sbjct:   74 LADAISIKVGPPPAPSGGLPAGTDNSDQARDFALALKDRFYLQPLPPTEAAARAKESAKDIINVKPLIDRKAWPYVQNDLRSKASYLRYDLNTIISSKPKDEKKSLKDLTTKLFDTIDNLDYAAKKKSPSQAEKYYAETVSALNEVLAKLG 224          
BLAST of CB250303 vs. ExPASy Swiss-Prot
Match: PSBQ_ONOVI (Oxygen-evolving enhancer protein 3, chloroplastic OS=Onobrychis viciifolia GN=PSBQ PE=2 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 3.081e-43
Identity = 94/151 (62.25%), Postives = 110/151 (72.85%), Query Frame = 2
Query:    2 LADATPIKVXXXXXXXXXXXXTLNSDEPRDLDLPLKERFFIQPLSPXXXXXXXXXXXKDILNVKELIDKKAWPYVQNDLRLRASYLRYDLNTIISAKPKDEKQSLK-NLTGKLFQTIGNLDHAAKIKSTPEAEKYYAETVSTLNDVLSKVG 451
            LA+A PIKV            TLNSDE RDL LPLKERF+IQPLSP           K+I+ VK+ ID+K      NDLRLRASYLRYDLNT+IS+KPK++KQSLK +  GKLFQ I NLD+AAK+KS P+AEKYYA+ VSTLNDVLSK+G
Sbjct:   81 LAEAKPIKVGGPPPPSGGLGGTLNSDEARDLKLPLKERFYIQPLSPTEAAQRQRESAKEIVAVKKFIDQKLGHMFINDLRLRASYLRYDLNTVISSKPKEQKQSLKESSAGKLFQDIDNLDYAAKLKSAPQAEKYYADAVSTLNDVLSKIG 231          
BLAST of CB250303 vs. ExPASy Swiss-Prot
Match: PSBQ_ORYSJ (Oxygen-evolving enhancer protein 3, chloroplastic OS=Oryza sativa subsp. japonica GN=Os07g0544800 PE=2 SV=1)

HSP 1 Score: 173.711 bits (439), Expect = 6.863e-43
Identity = 87/147 (59.18%), Postives = 106/147 (72.11%), Query Frame = 2
Query:   11 ATPIKVXXXXXXXXXXXXTLNSDEPRDLDLPLKERFFIQPLSPXXXXXXXXXXXKDILNVKELIDKKAWPYVQNDLRLRASYLRYDLNTIISAKPKDEKQSLKNLTGKLFQTIGNLDHAAKIKSTPEAEKYYAETVSTLNDVLSKVG 451
            A PIK+            TLNSD+ RD DLPL+ERF++QPL P           +DI+N+K LI+KK WP+V++DLRLRASYLRYDL T+I++KPKDEK+ LK+LTGKLF TI  LDHAAKIKS  EAEKYY  T S L DVL+K+G
Sbjct:   71 AKPIKLGPPPPPSGGLPGTLNSDQARDTDLPLRERFYLQPLPPAEAAARAKESAQDIINLKPLIEKKQWPFVRDDLRLRASYLRYDLKTVINSKPKDEKKGLKDLTGKLFATIDGLDHAAKIKSPEEAEKYYTLTKSALGDVLAKLG 217          
BLAST of CB250303 vs. ExPASy Swiss-Prot
Match: PSBQ_ORYSI (Oxygen-evolving enhancer protein 3, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_025465 PE=1 SV=2)

HSP 1 Score: 173.711 bits (439), Expect = 6.863e-43
Identity = 87/147 (59.18%), Postives = 106/147 (72.11%), Query Frame = 2
Query:   11 ATPIKVXXXXXXXXXXXXTLNSDEPRDLDLPLKERFFIQPLSPXXXXXXXXXXXKDILNVKELIDKKAWPYVQNDLRLRASYLRYDLNTIISAKPKDEKQSLKNLTGKLFQTIGNLDHAAKIKSTPEAEKYYAETVSTLNDVLSKVG 451
            A PIK+            TLNSD+ RD DLPL+ERF++QPL P           +DI+N+K LI+KK WP+V++DLRLRASYLRYDL T+I++KPKDEK+ LK+LTGKLF TI  LDHAAKIKS  EAEKYY  T S L DVL+K+G
Sbjct:   71 AKPIKLGPPPPPSGGLPGTLNSDQARDTDLPLRERFYLQPLPPAEAAARAKESAQDIINLKPLIEKKQWPFVRDDLRLRASYLRYDLKTVINSKPKDEKKGLKDLTGKLFATIDGLDHAAKIKSPEEAEKYYTLTKSALGDVLAKLG 217          
BLAST of CB250303 vs. ExPASy Swiss-Prot
Match: PSBQ_SPIOL (Oxygen-evolving enhancer protein 3, chloroplastic OS=Spinacia oleracea GN=PSBQ PE=1 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 7.588e-42
Identity = 89/151 (58.94%), Postives = 107/151 (70.86%), Query Frame = 2
Query:    2 LADATPIKVXXXXXXXXXXXXTLNSDEPRDLDLPL-KERFFIQPLSPXXXXXXXXXXXKDILNVKELIDKKAWPYVQNDLRLRASYLRYDLNTIISAKPKDEKQSLKNLTGKLFQTIGNLDHAAKIKSTPEAEKYYAETVSTLNDVLSKVG 451
            LA+A PI V            T NSD+ RD  LP  K+RF++QPL P            +ILNVK+ ID+KAWP +QNDLRLRASYLRYDL T+ISAKPKDEK+SL+ LT KLF +I NLDHAAKIKS  EAEKYY +TVS +N+VL+K+G
Sbjct:   82 LAEARPIVVGPPPPLSGGLPGTENSDQARDGTLPYTKDRFYLQPLPPTEAAQRAKVSASEILNVKQFIDRKAWPSLQNDLRLRASYLRYDLKTVISAKPKDEKKSLQELTSKLFSSIDNLDHAAKIKSPTEAEKYYGQTVSNINEVLAKLG 232          
The following BLAST results are available for this feature:
BLAST of CB250303 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 8
Match NameE-valueIdentityDescription
PSBQ2_ARATH1.865e-4865.10Oxygen-evolving enhancer protein 3-2, chloroplasti... [more]
PSBQ1_MAIZE1.745e-4669.77Oxygen-evolving enhancer protein 3-1, chloroplasti... [more]
PSBQ2_MAIZE3.888e-4668.99Oxygen-evolving enhancer protein 3-2, chloroplasti... [more]
PSBQ1_ARATH8.107e-4462.91Oxygen-evolving enhancer protein 3-1, chloroplasti... [more]
PSBQ_ONOVI3.081e-4362.25Oxygen-evolving enhancer protein 3, chloroplastic ... [more]
PSBQ_ORYSJ6.863e-4359.18Oxygen-evolving enhancer protein 3, chloroplastic ... [more]
PSBQ_ORYSI6.863e-4359.18Oxygen-evolving enhancer protein 3, chloroplastic ... [more]
PSBQ_SPIOL7.588e-4258.94Oxygen-evolving enhancer protein 3, chloroplastic ... [more]
back to top
Properties
Property NameValue
Genbank descriptionEST0086 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ120 similar to oxygen-evolving comples protein 16, OEC16 (acc# NP_192427), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250303 ID=CB250303|Name=CB250303|organism=Citrus sinensis|type=EST|length=631bp
ACTTGCTGATGCCACTCCCATCAAAGTTGGTCCTCCTCCTCCACCCTCTG
GCGGATTGCCTGGAACGTTGAACTCTGATGAGCCAAGAGACCTGGATCTG
CCACTGAAGGAGAGGTTCTTCATCCAACCACTTAGTCCAGCCCAGGCGGC
AGAGAGAGCAAAGGCGTCAGCAAAGGATATTCTTAATGTCAAGGAATTAA
TAGACAAGAAGGCCTGGCCCTATGTTCAGAATGATCTCCGTCTCAGGGCC
TCATACCTTCGCTATGACCTCAACACTATCATTTCTGCTAAGCCCAAAGA
TGAGAAACAATCCCTCAAGAACCTCACTGGAAAGCTCTTCCAGACCATCG
GCAATCTTGACCATGCGGCAAAGATTAAGAGCACTCCTGAAGCAGAGAAA
TACTATGCGGAGACTGTATCTACCCTGAACGATGTTCTCTCCAAGGTTGG
CTAAGCAGAATTAATATAATCTGATGTAAACTATATTTTTCATTTTGTGA
GGCAACAACTTCTGTGAATTTTATTGCAAGCTGGCGTTCCGCTCAAAGTA
TCGAGAATAATTTGTCCAGGGTGAAATGTCTATAATTTTAACTGCTAAGA
AACTGGCAGGCAGGCCCTGAAAAAAAAAAAA
back to top