CB250306

Overview
NameCB250306
Unique NameCB250306
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length322
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_BETVU (Elongation factor 2 OS=Beta vulgaris PE=2 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 5.382e-54
Identity = 102/106 (96.23%), Postives = 103/106 (97.17%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQRP 320
            LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLH DAIHRGGGQ+IPTARRV YASQLTAKPRLLEPVYLVEIQAPE ALGGIYSVLNQKRGHVFEEMQRP
Sbjct:  657 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHTDAIHRGGGQIIPTARRVFYASQLTAKPRLLEPVYLVEIQAPENALGGIYSVLNQKRGHVFEEMQRP 762          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_CHLKE (Elongation factor 2 OS=Chlorella kessleri PE=2 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 5.213e-49
Identity = 93/106 (87.74%), Postives = 100/106 (94.34%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQRP 320
            LNEIKDSVVA FQWASKEG LAEENMRGI FEVCDVVLHADAIHRGGGQ+IPTARR +YA+QLTA+PRLLEPVYLVEIQ PEQA+GG+YSVLNQKRG VFEE+QRP
Sbjct:  659 LNEIKDSVVAAFQWASKEGVLAEENMRGIVFEVCDVVLHADAIHRGGGQIIPTARRSMYAAQLTAQPRLLEPVYLVEIQCPEQAMGGVYSVLNQKRGMVFEELQRP 764          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_RAT (Elongation factor 2 OS=Rattus norvegicus GN=Eef2 PE=1 SV=4)

HSP 1 Score: 176.792 bits (447), Expect = 2.960e-44
Identity = 84/104 (80.77%), Postives = 94/104 (90.38%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQ 314
            LNEIKDSVVAGFQWA+KEGAL EENMRG+ F+V DV LHADAIHRGGGQ+IPTARR +YAS LTA+PRL+EP+YLVEIQ PEQ +GGIY VLN+KRGHVFEE Q
Sbjct:  672 LNEIKDSVVAGFQWATKEGALCEENMRGVRFDVHDVTLHADAIHRGGGQIIPTARRCLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQ 775          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_PONAB (Elongation factor 2 OS=Pongo abelii GN=EEF2 PE=2 SV=3)

HSP 1 Score: 176.792 bits (447), Expect = 2.960e-44
Identity = 84/104 (80.77%), Postives = 94/104 (90.38%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQ 314
            LNEIKDSVVAGFQWA+KEGAL EENMRG+ F+V DV LHADAIHRGGGQ+IPTARR +YAS LTA+PRL+EP+YLVEIQ PEQ +GGIY VLN+KRGHVFEE Q
Sbjct:  672 LNEIKDSVVAGFQWATKEGALCEENMRGVRFDVHDVTLHADAIHRGGGQIIPTARRCLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQ 775          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_MOUSE (Elongation factor 2 OS=Mus musculus GN=Eef2 PE=1 SV=2)

HSP 1 Score: 176.792 bits (447), Expect = 2.960e-44
Identity = 84/104 (80.77%), Postives = 94/104 (90.38%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQ 314
            LNEIKDSVVAGFQWA+KEGAL EENMRG+ F+V DV LHADAIHRGGGQ+IPTARR +YAS LTA+PRL+EP+YLVEIQ PEQ +GGIY VLN+KRGHVFEE Q
Sbjct:  672 LNEIKDSVVAGFQWATKEGALCEENMRGVRFDVHDVTLHADAIHRGGGQIIPTARRCLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQ 775          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_MESAU (Elongation factor 2 OS=Mesocricetus auratus GN=EEF2 PE=2 SV=3)

HSP 1 Score: 176.792 bits (447), Expect = 2.960e-44
Identity = 84/104 (80.77%), Postives = 94/104 (90.38%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQ 314
            LNEIKDSVVAGFQWA+KEGAL EENMRG+ F+V DV LHADAIHRGGGQ+IPTARR +YAS LTA+PRL+EP+YLVEIQ PEQ +GGIY VLN+KRGHVFEE Q
Sbjct:  672 LNEIKDSVVAGFQWATKEGALCEENMRGVRFDVHDVTLHADAIHRGGGQIIPTARRCLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQ 775          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_HUMAN (Elongation factor 2 OS=Homo sapiens GN=EEF2 PE=1 SV=4)

HSP 1 Score: 176.792 bits (447), Expect = 2.960e-44
Identity = 84/104 (80.77%), Postives = 94/104 (90.38%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQ 314
            LNEIKDSVVAGFQWA+KEGAL EENMRG+ F+V DV LHADAIHRGGGQ+IPTARR +YAS LTA+PRL+EP+YLVEIQ PEQ +GGIY VLN+KRGHVFEE Q
Sbjct:  672 LNEIKDSVVAGFQWATKEGALCEENMRGVRFDVHDVTLHADAIHRGGGQIIPTARRCLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQ 775          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_CALJA (Elongation factor 2 OS=Callithrix jacchus GN=EEF2 PE=2 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 2.960e-44
Identity = 84/104 (80.77%), Postives = 94/104 (90.38%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQ 314
            LNEIKDSVVAGFQWA+KEGAL EENMRG+ F+V DV LHADAIHRGGGQ+IPTARR +YAS LTA+PRL+EP+YLVEIQ PEQ +GGIY VLN+KRGHVFEE Q
Sbjct:  672 LNEIKDSVVAGFQWATKEGALCEENMRGVRFDVHDVTLHADAIHRGGGQIIPTARRCLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQ 775          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_BOVIN (Elongation factor 2 OS=Bos taurus GN=EEF2 PE=2 SV=3)

HSP 1 Score: 176.792 bits (447), Expect = 2.960e-44
Identity = 84/104 (80.77%), Postives = 94/104 (90.38%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQ 314
            LNEIKDSVVAGFQWA+KEGAL EENMRG+ F+V DV LHADAIHRGGGQ+IPTARR +YAS LTA+PRL+EP+YLVEIQ PEQ +GGIY VLN+KRGHVFEE Q
Sbjct:  672 LNEIKDSVVAGFQWATKEGALCEENMRGVRFDVHDVTLHADAIHRGGGQIIPTARRCLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEETQ 775          
BLAST of CB250306 vs. ExPASy Swiss-Prot
Match: EF2_CRIGR (Elongation factor 2 OS=Cricetulus griseus GN=EEF2 PE=3 SV=3)

HSP 1 Score: 173.711 bits (439), Expect = 2.506e-43
Identity = 83/104 (79.81%), Postives = 93/104 (89.42%), Query Frame = 3
Query:    3 LNEIKDSVVAGFQWASKEGALAEENMRGICFEVCDVVLHADAIHRGGGQVIPTARRVIYASQLTAKPRLLEPVYLVEIQAPEQALGGIYSVLNQKRGHVFEEMQ 314
            LNEIKDSVVAGFQWA+KEGAL EENMRG+ F+V DV LHADAIHR GGQ+IPTARR +YAS LTA+PRL+EP+YLVEIQ PEQ +GGIY VLN+KRGHVFEE Q
Sbjct:  672 LNEIKDSVVAGFQWATKEGALCEENMRGVRFDVHDVTLHADAIHRRGGQIIPTARRCLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQ 775          
The following BLAST results are available for this feature:
BLAST of CB250306 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 95
Match NameE-valueIdentityDescription
EF2_BETVU5.382e-5496.23Elongation factor 2 OS=Beta vulgaris PE=2 SV=1[more]
EF2_CHLKE5.213e-4987.74Elongation factor 2 OS=Chlorella kessleri PE=2 SV=... [more]
EF2_RAT2.960e-4480.77Elongation factor 2 OS=Rattus norvegicus GN=Eef2 P... [more]
EF2_PONAB2.960e-4480.77Elongation factor 2 OS=Pongo abelii GN=EEF2 PE=2 S... [more]
EF2_MOUSE2.960e-4480.77Elongation factor 2 OS=Mus musculus GN=Eef2 PE=1 S... [more]
EF2_MESAU2.960e-4480.77Elongation factor 2 OS=Mesocricetus auratus GN=EEF... [more]
EF2_HUMAN2.960e-4480.77Elongation factor 2 OS=Homo sapiens GN=EEF2 PE=1 S... [more]
EF2_CALJA2.960e-4480.77Elongation factor 2 OS=Callithrix jacchus GN=EEF2 ... [more]
EF2_BOVIN2.960e-4480.77Elongation factor 2 OS=Bos taurus GN=EEF2 PE=2 SV=... [more]
EF2_CRIGR2.506e-4379.81Elongation factor 2 OS=Cricetulus griseus GN=EEF2 ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionEST0090 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ125 similar to elongation factor 2 (acc# BAA77028), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250306 ID=CB250306|Name=CB250306|organism=Citrus sinensis|type=EST|length=322bp
ACTTGAATGAAATTAAGGATTCAGTTGTTGCTGGGTTCCAGTGGGCATCA
AAGGAAGGTGCATTGGCTGAAGAAAACATGAGGGGCATTTGCTTTGAAGT
TTGTGATGTGGTTCTTCATGCCGATGCTATCCACAGAGGTGGTGGCCAGG
TTATTCCAACTGCTAGAAGGGTCATTTATGCATCCCAGCTTACAGCCAAA
CCAAGGCTTCTTGAGCCTGTCTACTTGGTGGAAATCCAAGCTCCTGAACA
GGCACTTGGTGGTATTTACAGTGTTCTTAACCAGAAACGTGGTCACGTTT
TTGAGGAGATGCAGAGACCTGG
back to top