CB250333

Overview
NameCB250333
Unique NameCB250333
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length517
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig493 contig Csv1_Contig493:583..1099. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB250333 vs. ExPASy Swiss-Prot
Match: Y2197_ARATH (Probable protein kinase At2g41970 OS=Arabidopsis thaliana GN=At2g41970 PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 1.656e-13
Identity = 36/81 (44.44%), Postives = 53/81 (65.43%), Query Frame = 2
Query:    2 LLELLTGRKTISNDHPKGQESLVMWAKPILSSGKVTQLLDPALGNNYDYDQMERMVLASILCIRRDP*ARPQMSLVLKLLR 244
            LLELLTGRK + +  PKGQ+SLV WA P LS  KV Q +DP L N++    + ++   + LC++ +   RP M++V+K L+
Sbjct:  271 LLELLTGRKPVDHTMPKGQQSLVTWATPRLSEDKVKQCIDPKLNNDFPPKAVAKLAAVAALCVQYEADFRPNMTIVVKALQ 351          
BLAST of CB250333 vs. ExPASy Swiss-Prot
Match: Y2706_ARATH (Probable receptor-like protein kinase At2g47060 OS=Arabidopsis thaliana GN=At2g47060 PE=2 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 1.073e-12
Identity = 36/81 (44.44%), Postives = 52/81 (64.20%), Query Frame = 2
Query:    2 LLELLTGRKTISNDHPKGQESLVMWAKPILSSGKVTQLLDPALGNNYDYDQMERMVLASILCIRRDP*ARPQMSLVLKLLR 244
            LLELLTGRK + +  P+GQ+SLV WA P LS  KV Q +D  LG +Y    + ++   + LC++ +   RP MS+V+K L+
Sbjct:  270 LLELLTGRKPVDHRLPRGQQSLVTWATPKLSEDKVKQCVDARLGGDYPPKAVAKLAAVAALCVQYEADFRPNMSIVVKALQ 350          
BLAST of CB250333 vs. ExPASy Swiss-Prot
Match: PTI1_SOLLC (Pto-interacting protein 1 OS=Solanum lycopersicum GN=PTI1 PE=1 SV=2)

HSP 1 Score: 72.0182 bits (175), Expect = 1.830e-12
Identity = 36/81 (44.44%), Postives = 51/81 (62.96%), Query Frame = 2
Query:    2 LLELLTGRKTISNDHPKGQESLVMWAKPILSSGKVTQLLDPALGNNYDYDQMERMVLASILCIRRDP*ARPQMSLVLKLLR 244
            LLELLTGRK + +  P+GQ+SLV WA P LS  KV Q +D  L  +Y    + +M   + LC++ +   RP MS+V+K L+
Sbjct:  265 LLELLTGRKPVDHTLPRGQQSLVTWATPRLSEDKVKQCVDARLNTDYPPKAIAKMAAVAALCVQYEADFRPNMSIVVKALQ 345          
The following BLAST results are available for this feature:
BLAST of CB250333 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
Y2197_ARATH1.656e-1344.44Probable protein kinase At2g41970 OS=Arabidopsis t... [more]
Y2706_ARATH1.073e-1244.44Probable receptor-like protein kinase At2g47060 OS... [more]
PTI1_SOLLC1.830e-1244.44Pto-interacting protein 1 OS=Solanum lycopersicum ... [more]
back to top
Properties
Property NameValue
Genbank descriptionEST0122 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ178 similar to unknown Arabidopsis protein (acc# NP_177852), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250333 ID=CB250333|Name=CB250333|organism=Citrus sinensis|type=EST|length=517bp
ACTCCTTGAGCTTCTCACTGGAAGGAAGACTATAAGCAACGATCATCCAA
AAGGCCAAGAGAGCCTAGTCATGTGGGCAAAGCCAATTCTGAGCAGTGGG
AAGGTTACCCAGTTGTTAGATCCAGCCTTGGGCAACAACTATGACTATGA
CCAGATGGAGAGAATGGTTTTAGCATCTATTCTCTGTATCAGGCGTGACC
CTTGAGCTAGGCCTCAAATGAGCCTTGTTTTGAAGCTCCTCCGAGGTGAT
ACTGATGTGACCAAATGGGCAAGGTTACAAGTTAATGCTTCAGAAGAATC
TGAAATGCTGGATGATGAATCTTGCCCTCGTTCTAATCTCCAATCCCATC
TTAATCTTGCATTACTTGATGTGGAGGATGATTCATTCTCCATGAGCAGC
ATTGAGCAAAGTGTCTCATTAGAGGACTACTTGCTAGGAAGGTGGAGCCG
CTCATCAAGCTTTGACTGACCACATTACTGGCTTAAATCCCAAGTACCTG
CCCGGGCGGCCGCTCGA
back to top