CB250347

Overview
NameCB250347
Unique NameCB250347
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length350
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10666 contig Csv1_Contig10666:131..480. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB250347 vs. ExPASy Swiss-Prot
Match: KC1D_ARATH (Casein kinase I isoform delta-like OS=Arabidopsis thaliana GN=At4g26100 PE=2 SV=2)

HSP 1 Score: 96.6709 bits (239), Expect = 4.024e-20
Identity = 50/113 (44.25%), Postives = 77/113 (68.14%), Query Frame = 2
Query:   11 GRQGDYYVMVMDMLGPSLWDVWNNNSHTMSIEMVACIAIEAISILEKMHSKGYVHGDVKPENFLLGPPGTPDEKKLFPVDLGLATKWRDSTTGMHVEYDQRPDVFRGTVRYAS 349
            G +GDY V+VMD+LGPSL D++N  S  +S++ V  +A + I+ +E  HSK ++H D+KP+NFL+G     ++  ++ +D GLA K+RDSTT  H+ Y +  ++  GT RYAS
Sbjct:   72 GVEGDYNVLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEFFHSKSFLHRDLKPDNFLMGLGRRANQ--VYIIDFGLAKKYRDSTTHQHIPYRENKNL-TGTARYAS 181          
BLAST of CB250347 vs. ExPASy Swiss-Prot
Match: KC1E_MOUSE (Casein kinase I isoform epsilon OS=Mus musculus GN=Csnk1e PE=1 SV=2)

HSP 1 Score: 95.1301 bits (235), Expect = 1.171e-19
Identity = 50/113 (44.25%), Postives = 74/113 (65.49%), Query Frame = 2
Query:   11 GRQGDYYVMVMDMLGPSLWDVWNNNSHTMSIEMVACIAIEAISILEKMHSKGYVHGDVKPENFLLGPPGTPDEKKLFPVDLGLATKWRDSTTGMHVEYDQRPDVFRGTVRYAS 349
            G +GDY VMVM++LGPSL D++N  S   S++ V  +A + IS +E +HSK ++H DVKP+NFL+G         ++ +D GLA K+RD+ T  H+ Y +  ++  GT RYAS
Sbjct:   72 GAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL--GKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNL-TGTARYAS 181          
BLAST of CB250347 vs. ExPASy Swiss-Prot
Match: KC1E_HUMAN (Casein kinase I isoform epsilon OS=Homo sapiens GN=CSNK1E PE=1 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.171e-19
Identity = 50/113 (44.25%), Postives = 74/113 (65.49%), Query Frame = 2
Query:   11 GRQGDYYVMVMDMLGPSLWDVWNNNSHTMSIEMVACIAIEAISILEKMHSKGYVHGDVKPENFLLGPPGTPDEKKLFPVDLGLATKWRDSTTGMHVEYDQRPDVFRGTVRYAS 349
            G +GDY VMVM++LGPSL D++N  S   S++ V  +A + IS +E +HSK ++H DVKP+NFL+G         ++ +D GLA K+RD+ T  H+ Y +  ++  GT RYAS
Sbjct:   72 GAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL--GKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNL-TGTARYAS 181          
BLAST of CB250347 vs. ExPASy Swiss-Prot
Match: KC1E_CHICK (Casein kinase I isoform epsilon OS=Gallus gallus GN=CSNK1E PE=2 SV=2)

HSP 1 Score: 95.1301 bits (235), Expect = 1.171e-19
Identity = 50/113 (44.25%), Postives = 74/113 (65.49%), Query Frame = 2
Query:   11 GRQGDYYVMVMDMLGPSLWDVWNNNSHTMSIEMVACIAIEAISILEKMHSKGYVHGDVKPENFLLGPPGTPDEKKLFPVDLGLATKWRDSTTGMHVEYDQRPDVFRGTVRYAS 349
            G +GDY VMVM++LGPSL D++N  S   S++ V  +A + IS +E +HSK ++H DVKP+NFL+G         ++ +D GLA K+RD+ T  H+ Y +  ++  GT RYAS
Sbjct:   72 GAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL--GKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNL-TGTARYAS 181          
BLAST of CB250347 vs. ExPASy Swiss-Prot
Match: KC1D_XENTR (Casein kinase I isoform delta OS=Xenopus tropicalis GN=csnk1d PE=2 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.171e-19
Identity = 50/113 (44.25%), Postives = 74/113 (65.49%), Query Frame = 2
Query:   11 GRQGDYYVMVMDMLGPSLWDVWNNNSHTMSIEMVACIAIEAISILEKMHSKGYVHGDVKPENFLLGPPGTPDEKKLFPVDLGLATKWRDSTTGMHVEYDQRPDVFRGTVRYAS 349
            G +GDY VMVM++LGPSL D++N  S   S++ V  +A + IS +E +HSK ++H DVKP+NFL+G         ++ +D GLA K+RD+ T  H+ Y +  ++  GT RYAS
Sbjct:   72 GAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL--GKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNL-TGTARYAS 181          
BLAST of CB250347 vs. ExPASy Swiss-Prot
Match: KC1D_XENLA (Casein kinase I isoform delta OS=Xenopus laevis GN=csnk1d PE=1 SV=2)

HSP 1 Score: 95.1301 bits (235), Expect = 1.171e-19
Identity = 50/113 (44.25%), Postives = 74/113 (65.49%), Query Frame = 2
Query:   11 GRQGDYYVMVMDMLGPSLWDVWNNNSHTMSIEMVACIAIEAISILEKMHSKGYVHGDVKPENFLLGPPGTPDEKKLFPVDLGLATKWRDSTTGMHVEYDQRPDVFRGTVRYAS 349
            G +GDY VMVM++LGPSL D++N  S   S++ V  +A + IS +E +HSK ++H DVKP+NFL+G         ++ +D GLA K+RD+ T  H+ Y +  ++  GT RYAS
Sbjct:   72 GAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL--GKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNL-TGTARYAS 181          
BLAST of CB250347 vs. ExPASy Swiss-Prot
Match: KC1D_RAT (Casein kinase I isoform delta OS=Rattus norvegicus GN=Csnk1d PE=1 SV=2)

HSP 1 Score: 95.1301 bits (235), Expect = 1.171e-19
Identity = 50/113 (44.25%), Postives = 74/113 (65.49%), Query Frame = 2
Query:   11 GRQGDYYVMVMDMLGPSLWDVWNNNSHTMSIEMVACIAIEAISILEKMHSKGYVHGDVKPENFLLGPPGTPDEKKLFPVDLGLATKWRDSTTGMHVEYDQRPDVFRGTVRYAS 349
            G +GDY VMVM++LGPSL D++N  S   S++ V  +A + IS +E +HSK ++H DVKP+NFL+G         ++ +D GLA K+RD+ T  H+ Y +  ++  GT RYAS
Sbjct:   72 GAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL--GKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNL-TGTARYAS 181          
BLAST of CB250347 vs. ExPASy Swiss-Prot
Match: KC1D_MOUSE (Casein kinase I isoform delta OS=Mus musculus GN=Csnk1d PE=1 SV=2)

HSP 1 Score: 95.1301 bits (235), Expect = 1.171e-19
Identity = 50/113 (44.25%), Postives = 74/113 (65.49%), Query Frame = 2
Query:   11 GRQGDYYVMVMDMLGPSLWDVWNNNSHTMSIEMVACIAIEAISILEKMHSKGYVHGDVKPENFLLGPPGTPDEKKLFPVDLGLATKWRDSTTGMHVEYDQRPDVFRGTVRYAS 349
            G +GDY VMVM++LGPSL D++N  S   S++ V  +A + IS +E +HSK ++H DVKP+NFL+G         ++ +D GLA K+RD+ T  H+ Y +  ++  GT RYAS
Sbjct:   72 GAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL--GKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNL-TGTARYAS 181          
BLAST of CB250347 vs. ExPASy Swiss-Prot
Match: KC1D_HUMAN (Casein kinase I isoform delta OS=Homo sapiens GN=CSNK1D PE=1 SV=2)

HSP 1 Score: 95.1301 bits (235), Expect = 1.171e-19
Identity = 50/113 (44.25%), Postives = 74/113 (65.49%), Query Frame = 2
Query:   11 GRQGDYYVMVMDMLGPSLWDVWNNNSHTMSIEMVACIAIEAISILEKMHSKGYVHGDVKPENFLLGPPGTPDEKKLFPVDLGLATKWRDSTTGMHVEYDQRPDVFRGTVRYAS 349
            G +GDY VMVM++LGPSL D++N  S   S++ V  +A + IS +E +HSK ++H DVKP+NFL+G         ++ +D GLA K+RD+ T  H+ Y +  ++  GT RYAS
Sbjct:   72 GAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL--GKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNL-TGTARYAS 181          
BLAST of CB250347 vs. ExPASy Swiss-Prot
Match: KC1D_BOVIN (Casein kinase I isoform delta OS=Bos taurus GN=CSNK1D PE=2 SV=2)

HSP 1 Score: 95.1301 bits (235), Expect = 1.171e-19
Identity = 50/113 (44.25%), Postives = 74/113 (65.49%), Query Frame = 2
Query:   11 GRQGDYYVMVMDMLGPSLWDVWNNNSHTMSIEMVACIAIEAISILEKMHSKGYVHGDVKPENFLLGPPGTPDEKKLFPVDLGLATKWRDSTTGMHVEYDQRPDVFRGTVRYAS 349
            G +GDY VMVM++LGPSL D++N  S   S++ V  +A + IS +E +HSK ++H DVKP+NFL+G         ++ +D GLA K+RD+ T  H+ Y +  ++  GT RYAS
Sbjct:   72 GAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKTVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGL--GKKGNLVYIIDFGLAKKYRDARTHQHIPYRENKNL-TGTARYAS 181          
The following BLAST results are available for this feature:
BLAST of CB250347 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 61
Match NameE-valueIdentityDescription
KC1D_ARATH4.024e-2044.25Casein kinase I isoform delta-like OS=Arabidopsis ... [more]
KC1E_MOUSE1.171e-1944.25Casein kinase I isoform epsilon OS=Mus musculus GN... [more]
KC1E_HUMAN1.171e-1944.25Casein kinase I isoform epsilon OS=Homo sapiens GN... [more]
KC1E_CHICK1.171e-1944.25Casein kinase I isoform epsilon OS=Gallus gallus G... [more]
KC1D_XENTR1.171e-1944.25Casein kinase I isoform delta OS=Xenopus tropicali... [more]
KC1D_XENLA1.171e-1944.25Casein kinase I isoform delta OS=Xenopus laevis GN... [more]
KC1D_RAT1.171e-1944.25Casein kinase I isoform delta OS=Rattus norvegicus... [more]
KC1D_MOUSE1.171e-1944.25Casein kinase I isoform delta OS=Mus musculus GN=C... [more]
KC1D_HUMAN1.171e-1944.25Casein kinase I isoform delta OS=Homo sapiens GN=C... [more]
KC1D_BOVIN1.171e-1944.25Casein kinase I isoform delta OS=Bos taurus GN=CSN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionEST0137 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ202 similar to casein kinase (acc# NP_180147), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250347 ID=CB250347|Name=CB250347|organism=Citrus sinensis|type=EST|length=350bp
ACACTTCAAGGGCCGGCAAGGTGACTATTATGTGATGGTAATGGATATGC
TGGGACCAAGCTTGTGGGATGTATGGAATAATAACTCGCATACAATGTCC
ATTGAAATGGTTGCCTGCATTGCCATTGAAGCAATATCGATATTGGAGAA
GATGCACTCCAAAGGGTATGTGCATGGAGATGTGAAGCCTGAAAATTTTC
TGCTTGGTCCTCCTGGAACACCTGATGAGAAGAAATTATTCCCTGTTGAC
CTTGGACTAGCTACTAAATGGCGAGACAGCACAACTGGCATGCATGTTGA
ATATGACCAAAGGCCTGATGTTTTCAGGGGAACAGTCCGTTATGCTAGTG
back to top