CB250356

Overview
NameCB250356
Unique NameCB250356
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length464
Libraries
Library NameType
Mature fruit abscission zone cDNA subtraction librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7556 contig Csv1_Contig7556:35..498. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB250356 vs. ExPASy Swiss-Prot
Match: PDIA6_ARATH (Probable protein disulfide-isomerase A6 OS=Arabidopsis thaliana GN=At2g47470 PE=1 SV=1)

HSP 1 Score: 249.98 bits (637), Expect = 3.689e-66
Identity = 116/144 (80.56%), Postives = 128/144 (88.89%), Query Frame = 2
Query:   32 MERYQIWLALGTLTLFFVSALADDVVVLTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYERLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVV 463
            M + QIW     L L  VSA+ADDVVVLT+D+FEKEVG+D+GALVEFYAPWCGHCKKLAPEYE+LGASFKKAKSVLI KVDCDE KS+C+KYGV GYPTIQWFPKGSLEP+KYEGPR+ EALAEYVN EGGTNVK+AAVP NVV
Sbjct:    1 MAKSQIWFGFALLALLLVSAVADDVVVLTDDSFEKEVGKDKGALVEFYAPWCGHCKKLAPEYEKLGASFKKAKSVLIAKVDCDEQKSVCTKYGVSGYPTIQWFPKGSLEPQKYEGPRNAEALAEYVNKEGGTNVKLAAVPQNVV 144          

HSP 2 Score: 121.324 bits (303), Expect = 1.979e-27
Identity = 54/117 (46.15%), Postives = 80/117 (68.38%), Query Frame = 2
Query:   83 VSALADDVVVLTEDNFEKEV-GQDRGALVEFYAPWCGHCKKLAPEYERLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTN 430
            ++A+  +VVVLT DNF++ V  Q++  LVEFYAPWCGHCK LAP YE++   FK+ + V+I  +D D HK+L  KYGV G+PT+++FPK +     Y+G R  +    ++N + GT+
Sbjct:  136 LAAVPQNVVVLTPDNFDEIVLDQNKDVLVEFYAPWCGHCKSLAPTYEKVATVFKQEEGVVIANLDADAHKALGEKYGVSGFPTLKFFPKDNKAGHDYDGGRDLDDFVSFINEKSGTS 252          
BLAST of CB250356 vs. ExPASy Swiss-Prot
Match: PDIA6_MEDSA (Probable protein disulfide-isomerase A6 OS=Medicago sativa PE=2 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 2.238e-63
Identity = 115/149 (77.18%), Postives = 127/149 (85.23%), Query Frame = 2
Query:   29 EMERYQIW----LALGTLTLFFVSALADDVVVLTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYERLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVV 463
            +ME +QIW    LA     + FVS  ADDVVVLTE+NFEKEVG D+GALVEFYAPWCGHCKKLAPEYE+L  SFKKAKSVLI KVDCDEHKS+CSKYGV GYPTIQWFPKGSLEPKK+EGPR+ E+LAE+VN EGGTNVKIA  PS+VV
Sbjct:    2 KMEMHQIWSRIALASFAFAILFVSVSADDVVVLTEENFEKEVGHDKGALVEFYAPWCGHCKKLAPEYEKLPNSFKKAKSVLIAKVDCDEHKSVCSKYGVSGYPTIQWFPKGSLEPKKFEGPRTAESLAEFVNTEGGTNVKIATAPSHVV 150          

HSP 2 Score: 107.842 bits (268), Expect = 2.264e-23
Identity = 49/117 (41.88%), Postives = 72/117 (61.54%), Query Frame = 2
Query:   83 VSALADDVVVLTEDNFEKEV-GQDRGALVEFYAPWCGHCKKLAPEYERLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTN 430
            ++     VVVLT + F + V    +  LVEFYAPWCGHCK LAP YE++ A FK    V+I  +D D+++ L  KY V G+PT+++FPKG+   + Y G R  +    ++N + GT+
Sbjct:  142 IATAPSHVVVLTPETFNEVVLDGTKDVLVEFYAPWCGHCKSLAPIYEKVAAVFKSEDDVVIANLDADKYRDLAEKYDVSGFPTLKFFPKGNKAGEDYGGGRDLDDFVAFINEKSGTS 258          
BLAST of CB250356 vs. ExPASy Swiss-Prot
Match: PDI1_DICDI (Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2)

HSP 1 Score: 129.028 bits (323), Expect = 9.491e-30
Identity = 67/142 (47.18%), Postives = 90/142 (63.38%), Query Frame = 2
Query:   47 IWLALGTLTLFFVSALADDVVVLTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYERLGASFKK-AKSVLIGKVDCD--EHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVV 463
            +++ L  L    + +   +VVVL+ DNF+  V   +   V+FYAPWCGHCKKLAP++E L  +F   +  V+I KVDCD  ++K+LCSKY V GYPT++ F K S   K Y G RS + L  Y+NN   TNVK+   PSNVV
Sbjct:    5 LFVTLIALAFVALCSAEGNVVVLSPDNFDTVVDGSKTVFVKFYAPWCGHCKKLAPDFEILADTFAPVSNKVVIAKVDCDQADNKALCSKYDVSGYPTLKIFDK-STTAKDYNGARSVDELLTYINNHAKTNVKVKKAPSNVV 145          

HSP 2 Score: 122.479 bits (306), Expect = 8.883e-28
Identity = 56/119 (47.06%), Postives = 78/119 (65.55%), Query Frame = 2
Query:   83 VSALADDVVVLTEDNFEKEV-GQDRGALVEFYAPWCGHCKKLAPEYERLGASFKKAKSVLIGKVDCD--EHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTN 430
            V     +VV L+  NF+  V  + +  LVEFYAPWCGHCKKL P+YE LG ++   K V+I K+DCD  ++K++CSKYGV G+PT++WF K S + +KYE  R  +    Y+N + G N
Sbjct:  137 VKKAPSNVVDLSPSNFDSVVLDKSKNVLVEFYAPWCGHCKKLMPDYEILGNTYANEKDVVIAKIDCDAADNKAICSKYGVTGFPTLKWFGKQSKDGEKYEQGRDLDTFINYINKQAGVN 255          
BLAST of CB250356 vs. ExPASy Swiss-Prot
Match: PDI2_SCHPO (Protein disulfide-isomerase C17H9.14c OS=Schizosaccharomyces pombe GN=SPAC17H9.14c PE=2 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 3.732e-26
Identity = 50/104 (48.08%), Postives = 67/104 (64.42%), Query Frame = 2
Query:  152 RGALVEFYAPWCGHCKKLAPEYERLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTNVKIAAVPSNVV 463
            +GAL+EFYA WCGHCK LAP YE LGA F+    VLIGK+D D H  +  KY + G+PT+ WFP    EP +Y   R  ++L ++V+ + G   +   +PSNVV
Sbjct:   40 KGALIEFYATWCGHCKSLAPVYEELGALFEDHNDVLIGKIDADTHSDVADKYHITGFPTLIWFPPDGSEPVQYSNARDVDSLTQFVSEKTGIKKRKIVLPSNVV 143          

HSP 2 Score: 100.138 bits (248), Expect = 4.721e-21
Identity = 53/114 (46.49%), Postives = 71/114 (62.28%), Query Frame = 2
Query:   92 LADDVVVLTEDNFEKEVGQDR-GALVEFYAPWCGHCKKLAPEYERLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLE-PKKYEGPRSTEALAEYVNNEGGT 427
            L  +VV L   NF+K V  D+   LVEFYA WCG+CK+LAP YE LG  FK   +V I K++ D    +   + V  +PTI++FPK   + P+ YEG RS E+L EY+N + GT
Sbjct:  138 LPSNVVELDSLNFDKVVMDDKKDVLVEFYADWCGYCKRLAPTYETLGKVFKNEPNVEIVKINADVFADIGRLHEVASFPTIKFFPKDDKDKPELYEGDRSLESLIEYINKKSGT 251          
BLAST of CB250356 vs. ExPASy Swiss-Prot
Match: TIGA_ASPNG (Protein disulfide-isomerase tigA OS=Aspergillus niger GN=tigA PE=2 SV=1)

HSP 1 Score: 115.161 bits (287), Expect = 1.418e-25
Identity = 58/119 (48.74%), Postives = 78/119 (65.55%), Query Frame = 2
Query:   74 LFFVSALADDVVVLTEDNFEKEVGQD-RGALVEFYAPWCGHCKKLAPEYERLGASFKKAKS-VLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGG 424
            L   SA+   VV L   NF+  V +  + ALVEF+APWCGHCK LAP YE LG +F  A   V +GKVD DEH+ L  K+GVQG+PT++WF   S EP+ Y+G R  E+L+ +++ + G
Sbjct:   11 LGLASAVTAAVVDLVPKNFDDVVLKSGKPALVEFFAPWCGHCKNLAPVYEELGQAFAHASDKVTVGKVDADEHRDLGRKFGVQGFPTLKWFDGKSDEPEDYKGGRDLESLSSFISEKTG 129          

HSP 2 Score: 104.375 bits (259), Expect = 2.503e-22
Identity = 52/111 (46.85%), Postives = 68/111 (61.26%), Query Frame = 2
Query:  104 VVVLTEDNFEKEVGQDRGALVEFYAPWCGHCKKLAPEYERLGASFKKAKSVLIGKVDCDEH--KSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGGTN 430
            V +L +  F+  VG D   LV F APWCGHCK LAP +E L   F    +V+I KVD D    K+   + GV GYPTI++FPKGS E   YEG RS +A  +++N + GT+
Sbjct:  142 VEMLNDATFKGAVGGDNDVLVAFTAPWCGHCKNLAPTWEALANDFVLEPNVVIAKVDADAENGKATAREQGVSGYPTIKFFPKGSTESVPYEGARSEQAFIDFLNEKTGTH 252          
BLAST of CB250356 vs. ExPASy Swiss-Prot
Match: PDIA3_BOVIN (Protein disulfide-isomerase A3 OS=Bos taurus GN=PDIA3 PE=2 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 3.862e-23
Identity = 56/134 (41.79%), Postives = 76/134 (56.72%), Query Frame = 2
Query:   32 MERYQIWLALGTLTLFFVSALADDVVVLTEDNFEKEV---GQDRGALVEFYAPWCGHCKKLAPEYERLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGG 424
            + R  ++  L  L      A A DV+ LT+DNFE  +   G     LVEF+APWCGHCKKLAPEYE      K    V + KVDC  + + C+KYGV GYPT++ F  G  E   Y+GPR+ + +  ++  + G
Sbjct:    3 LRRLALFPGLALLLAAARLAAASDVLELTDDNFESRITDTGSSGLMLVEFFAPWCGHCKKLAPEYEAAATRLKGI--VPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGE-ESGAYDGPRTADGIVSHLKKQAG 133          

HSP 2 Score: 87.4261 bits (215), Expect = 3.167e-17
Identity = 43/107 (40.19%), Postives = 65/107 (60.75%), Query Frame = 2
Query:  104 VVVLTEDNFEKEVG-QDRGALVEFYAPWCGHCKKLAPEYERLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLE-PKKYEGPRSTEALAEYVNNE 418
            V V+  +NF++ V  +++  L+EFYAPWCGHCK L P+Y+ LG   +K  +++I K+D   +  + S Y V+G+PTI + P    + PKKYEG R       Y+  E
Sbjct:  378 VKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLRKDPNIVIAKMDATAN-DVPSPYEVRGFPTIYFSPANKKQNPKKYEGGRELSDFISYLKRE 483          
BLAST of CB250356 vs. ExPASy Swiss-Prot
Match: PDIA3_CERAE (Protein disulfide-isomerase A3 OS=Cercopithecus aethiops GN=PDIA3 PE=2 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 5.044e-23
Identity = 53/115 (46.09%), Postives = 70/115 (60.87%), Query Frame = 2
Query:   89 ALADDVVVLTEDNFEKEVGQDRGA---LVEFYAPWCGHCKKLAPEYERLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGG 424
            A A DV+ LT+DNFE  V     A   LVEF+APWCGHCK+LAPEYE      K    V + KVDC  + + C+KYGV GYPT++ F  G  E   Y+GPR+ + +  ++  + G
Sbjct:   22 AAASDVLELTDDNFESRVSDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGI--VPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGE-EAGAYDGPRTADGIVSHLKKQAG 133          

HSP 2 Score: 88.1965 bits (217), Expect = 1.857e-17
Identity = 44/107 (41.12%), Postives = 64/107 (59.81%), Query Frame = 2
Query:  104 VVVLTEDNFEKEVG-QDRGALVEFYAPWCGHCKKLAPEYERLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKG-SLEPKKYEGPRSTEALAEYVNNE 418
            V V+  +NF++ V  +++  L+EFYAPWCGHCK L P+Y+ LG    K  +++I K+D   +  + S Y V+G+PTI + P    L PKKYEG R       Y+  E
Sbjct:  378 VKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATAN-DVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQRE 483          
BLAST of CB250356 vs. ExPASy Swiss-Prot
Match: PDIA3_RAT (Protein disulfide-isomerase A3 OS=Rattus norvegicus GN=Pdia3 PE=1 SV=2)

HSP 1 Score: 106.301 bits (264), Expect = 6.588e-23
Identity = 57/135 (42.22%), Postives = 77/135 (57.04%), Query Frame = 2
Query:   38 RYQIWLALGTLTLFFVSAL---ADDVVVLTEDNFEKEVGQDRGA---LVEFYAPWCGHCKKLAPEYERLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGG 424
            R+     L  + L   SAL   A DV+ LT++NFE  V     A   LVEF+APWCGHCK+LAPEYE      K    V + KVDC  + + C+KYGV GYPT++ F  G  E   Y+GPR+ + +  ++  + G
Sbjct:    2 RFSCLALLPGVALLLASALLASASDVLELTDENFESRVSDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGI--VPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGE-EAGAYDGPRTADGIVSHLKKQAG 133          

HSP 2 Score: 87.0409 bits (214), Expect = 4.136e-17
Identity = 44/107 (41.12%), Postives = 63/107 (58.88%), Query Frame = 2
Query:  104 VVVLTEDNFEKEVG-QDRGALVEFYAPWCGHCKKLAPEYERLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKG-SLEPKKYEGPRSTEALAEYVNNE 418
            V V+  ++F+  V  +D+  L+EFYAPWCGHCK L P+Y+ LG    K  +++I K+D   +  + S Y V+G+PTI + P    L PKKYEG R       Y+  E
Sbjct:  378 VKVVVAESFDDIVNAEDKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATAN-DVPSPYEVKGFPTIYFSPANKKLTPKKYEGGRELNDFISYLQRE 483          
BLAST of CB250356 vs. ExPASy Swiss-Prot
Match: PDIA3_PONAB (Protein disulfide-isomerase A3 OS=Pongo abelii GN=PDIA3 PE=2 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 6.588e-23
Identity = 52/115 (45.22%), Postives = 70/115 (60.87%), Query Frame = 2
Query:   89 ALADDVVVLTEDNFEKEVGQDRGA---LVEFYAPWCGHCKKLAPEYERLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGG 424
            A A DV+ LT+DNFE  +     A   LVEF+APWCGHCK+LAPEYE      K    V + KVDC  + + C+KYGV GYPT++ F  G  E   Y+GPR+ + +  ++  + G
Sbjct:   22 AAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGI--VPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGE-EAGAYDGPRTADGIVSHLKKQAG 133          

HSP 2 Score: 88.1965 bits (217), Expect = 1.857e-17
Identity = 44/107 (41.12%), Postives = 64/107 (59.81%), Query Frame = 2
Query:  104 VVVLTEDNFEKEVG-QDRGALVEFYAPWCGHCKKLAPEYERLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKG-SLEPKKYEGPRSTEALAEYVNNE 418
            V V+  +NF++ V  +++  L+EFYAPWCGHCK L P+Y+ LG    K  +++I K+D   +  + S Y V+G+PTI + P    L PKKYEG R       Y+  E
Sbjct:  378 VKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATAN-DVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQRE 483          
BLAST of CB250356 vs. ExPASy Swiss-Prot
Match: PDIA3_HUMAN (Protein disulfide-isomerase A3 OS=Homo sapiens GN=PDIA3 PE=1 SV=4)

HSP 1 Score: 106.301 bits (264), Expect = 6.588e-23
Identity = 52/115 (45.22%), Postives = 70/115 (60.87%), Query Frame = 2
Query:   89 ALADDVVVLTEDNFEKEVGQDRGA---LVEFYAPWCGHCKKLAPEYERLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKGSLEPKKYEGPRSTEALAEYVNNEGG 424
            A A DV+ LT+DNFE  +     A   LVEF+APWCGHCK+LAPEYE      K    V + KVDC  + + C+KYGV GYPT++ F  G  E   Y+GPR+ + +  ++  + G
Sbjct:   22 AAASDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGI--VPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGE-EAGAYDGPRTADGIVSHLKKQAG 133          

HSP 2 Score: 88.1965 bits (217), Expect = 1.857e-17
Identity = 44/107 (41.12%), Postives = 64/107 (59.81%), Query Frame = 2
Query:  104 VVVLTEDNFEKEVG-QDRGALVEFYAPWCGHCKKLAPEYERLGASFKKAKSVLIGKVDCDEHKSLCSKYGVQGYPTIQWFPKG-SLEPKKYEGPRSTEALAEYVNNE 418
            V V+  +NF++ V  +++  L+EFYAPWCGHCK L P+Y+ LG    K  +++I K+D   +  + S Y V+G+PTI + P    L PKKYEG R       Y+  E
Sbjct:  378 VKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATAN-DVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQRE 483          
The following BLAST results are available for this feature:
BLAST of CB250356 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 87
Match NameE-valueIdentityDescription
PDIA6_ARATH3.689e-6680.56Probable protein disulfide-isomerase A6 OS=Arabido... [more]
PDIA6_MEDSA2.238e-6377.18Probable protein disulfide-isomerase A6 OS=Medicag... [more]
PDI1_DICDI9.491e-3047.18Protein disulfide-isomerase 1 OS=Dictyostelium dis... [more]
PDI2_SCHPO3.732e-2648.08Protein disulfide-isomerase C17H9.14c OS=Schizosac... [more]
TIGA_ASPNG1.418e-2548.74Protein disulfide-isomerase tigA OS=Aspergillus ni... [more]
PDIA3_BOVIN3.862e-2341.79Protein disulfide-isomerase A3 OS=Bos taurus GN=PD... [more]
PDIA3_CERAE5.044e-2346.09Protein disulfide-isomerase A3 OS=Cercopithecus ae... [more]
PDIA3_RAT6.588e-2342.22Protein disulfide-isomerase A3 OS=Rattus norvegicu... [more]
PDIA3_PONAB6.588e-2345.22Protein disulfide-isomerase A3 OS=Pongo abelii GN=... [more]
PDIA3_HUMAN6.588e-2345.22Protein disulfide-isomerase A3 OS=Homo sapiens GN=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionEST0150 Mature fruit abscission zone cDNA subtraction library Citrus sinensis cDNA clone MFAZ219 similar to protein disulfide isomerase (acc# NP_182269), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB250356 ID=CB250356|Name=CB250356|organism=Citrus sinensis|type=EST|length=464bp
CACGGGGGGAAAAAAAAAAAGAAAGAGAGAAATGGAGAGGTATCAGATCT
GGCTAGCTCTAGGCACTTTAACCTTGTTCTTCGTATCAGCTCTAGCGGAC
GATGTCGTTGTGCTAACAGAAGACAACTTCGAGAAGGAGGTTGGTCAGGA
CAGGGGAGCTCTTGTTGAGTTTTACGCTCCTTGGTGTGGCCACTGTAAAA
AGCTTGCTCCAGAGTATGAGAGACTTGGTGCAAGCTTTAAGAAAGCAAAG
TCTGTCTTGATTGGAAAGGTGGACTGTGACGAGCATAAGAGCTTATGCAG
CAAATATGGTGTTCAAGGATACCCAACAATTCAATGGTTTCCTAAAGGTT
CTTTGGAACCCAAAAAGTATGAAGGGCCACGATCTACTGAAGCCCTTGCT
GAGTATGTGAATAATGAAGGAGGAACCAATGTGAAGATAGCTGCAGTCCC
ATCCAATGTGGTGG
back to top