CB290207

Overview
NameCB290207
Unique NameCB290207
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length724
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9664 contig Csv1_Contig9664:772..1495. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB290207 vs. ExPASy Swiss-Prot
Match: CATB_RAT (Cathepsin B OS=Rattus norvegicus GN=Ctsb PE=1 SV=2)

HSP 1 Score: 158.303 bits (399), Expect = 3.835e-38
Identity = 70/141 (49.65%), Postives = 97/141 (68.79%), Query Frame = -2
Query:  280 SHPGCEPAYPTPKCVRKC-VKKNQLWRNSKHSSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKFGVYKHIPGDVMGGHAVKLIGWGTSDDGEDYWILANQWNRSWGADGYFKIKRGSNECGIEEDVVAGLPSSK 699
            S P C     TPKC + C    +  ++  KH   ++Y ++   ++IMAEIYKNGPVE +FTV+ DF  YK GVYKH  GDVMGGHA++++GWG  ++G  YW++AN WN  WG +G+FKI RG N CGIE ++VAG+P ++
Sbjct:  194 SRPPCTGEGDTPKCNKMCEAGYSTSYKEDKHYGYTSYSVSDSEKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDVMGGHAIRILGWGI-ENGVPYWLVANSWNVDWGDNGFFKILRGENHCGIESEIVAGIPRTQ 333          
BLAST of CB290207 vs. ExPASy Swiss-Prot
Match: CATB_PIG (Cathepsin B OS=Sus scrofa GN=CTSB PE=1 SV=1)

HSP 1 Score: 158.303 bits (399), Expect = 3.835e-38
Identity = 69/138 (50.00%), Postives = 95/138 (68.84%), Query Frame = -2
Query:  289 SHPGCEPAYPTPKCVRKCVKK-NQLWRNSKHSSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKFGVYKHIPGDVMGGHAVKLIGWGTSDDGEDYWILANQWNRSWGADGYFKIKRGSNECGIEEDVVAGLP 699
            S P C     TPKC + C       ++  KH   S+Y I+ + ++IMAEIYKNGPVE +FTVY DF  YK GVY+H+ GD+MGGHA++++GWG  ++G  YW++ N WN  WG +G+FKI RG + CGIE ++VAG+P
Sbjct:  194 SRPPCTGEGDTPKCSKICEPGYTPSYKEDKHFGCSSYSISRNEKEIMAEIYKNGPVEGAFTVYSDFLQYKSGVYQHVTGDLMGGHAIRILGWGV-ENGTPYWLVGNSWNTDWGDNGFFKILRGQDHCGIESEIVAGIP 330          
BLAST of CB290207 vs. ExPASy Swiss-Prot
Match: CATB_MACFA (Cathepsin B OS=Macaca fascicularis GN=CTSB PE=2 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 6.541e-38
Identity = 69/147 (46.94%), Postives = 101/147 (68.71%), Query Frame = -2
Query:  262 SHPGCEPAYPTPKCVRKCVKK-NQLWRNSKHSSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKFGVYKHIPGDVMGGHAVKLIGWGTSDDGEDYWILANQWNRSWGADGYFKIKRGSNECGIEEDVVAGLPSSKNLVKEI 699
            S P C     TPKC + C    +  ++  KH   ++Y +++  +DIMAEIYKNGPVE +F+VY DF  YK GVY+H+ G++MGGHA++++GWG  ++G  YW++AN WN  WG +G+FKI RG + CGIE +VVAG+P +    ++I
Sbjct:  194 SRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGV-ENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI 339          
BLAST of CB290207 vs. ExPASy Swiss-Prot
Match: CATB_HUMAN (Cathepsin B OS=Homo sapiens GN=CTSB PE=1 SV=3)

HSP 1 Score: 157.532 bits (397), Expect = 6.541e-38
Identity = 69/147 (46.94%), Postives = 101/147 (68.71%), Query Frame = -2
Query:  262 SHPGCEPAYPTPKCVRKCVKK-NQLWRNSKHSSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKFGVYKHIPGDVMGGHAVKLIGWGTSDDGEDYWILANQWNRSWGADGYFKIKRGSNECGIEEDVVAGLPSSKNLVKEI 699
            S P C     TPKC + C    +  ++  KH   ++Y +++  +DIMAEIYKNGPVE +F+VY DF  YK GVY+H+ G++MGGHA++++GWG  ++G  YW++AN WN  WG +G+FKI RG + CGIE +VVAG+P +    ++I
Sbjct:  194 SRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGV-ENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI 339          
BLAST of CB290207 vs. ExPASy Swiss-Prot
Match: CATB_PONAB (Cathepsin B OS=Pongo abelii GN=CTSB PE=2 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 8.542e-38
Identity = 69/147 (46.94%), Postives = 100/147 (68.03%), Query Frame = -2
Query:  262 SHPGCEPAYPTPKCVRKCVKK-NQLWRNSKHSSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKFGVYKHIPGDVMGGHAVKLIGWGTSDDGEDYWILANQWNRSWGADGYFKIKRGSNECGIEEDVVAGLPSSKNLVKEI 699
            S P C     TPKC + C    +  ++  KH   ++Y +++   DIMAEIYKNGPVE +F+VY DF  YK GVY+H+ G++MGGHA++++GWG  ++G  YW++AN WN  WG +G+FKI RG + CGIE +VVAG+P +    ++I
Sbjct:  194 SRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSERDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGV-ENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI 339          
BLAST of CB290207 vs. ExPASy Swiss-Prot
Match: CATB_MOUSE (Cathepsin B OS=Mus musculus GN=Ctsb PE=1 SV=2)

HSP 1 Score: 155.992 bits (393), Expect = 1.903e-37
Identity = 68/138 (49.28%), Postives = 95/138 (68.84%), Query Frame = -2
Query:  289 SHPGCEPAYPTPKCVRKC-VKKNQLWRNSKHSSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKFGVYKHIPGDVMGGHAVKLIGWGTSDDGEDYWILANQWNRSWGADGYFKIKRGSNECGIEEDVVAGLP 699
            S P C     TP+C + C    +  ++  KH   ++Y +++  ++IMAEIYKNGPVE +FTV+ DF  YK GVYKH  GD+MGGHA++++GWG  ++G  YW+ AN WN  WG +G+FKI RG N CGIE ++VAG+P
Sbjct:  194 SRPPCTGEGDTPRCNKSCEAGYSPSYKEDKHFGYTSYSVSNSVKEIMAEIYKNGPVEGAFTVFSDFLTYKSGVYKHEAGDMMGGHAIRILGWGV-ENGVPYWLAANSWNLDWGDNGFFKILRGENHCGIESEIVAGIP 330          
BLAST of CB290207 vs. ExPASy Swiss-Prot
Match: CPR5_CAEEL (Cathepsin B-like cysteine proteinase 5 OS=Caenorhabditis elegans GN=cpr-5 PE=1 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 2.485e-37
Identity = 74/143 (51.75%), Postives = 88/143 (61.54%), Query Frame = -2
Query:  289 GCSHPGC-EPAYPTPKCVRKCVKKNQL---WRNSKHSSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKFGVYKHIPGDVMGGHAVKLIGWGTSDDGEDYWILANQWNRSWGADGYFKIKRGSNECGIEEDVVAGLP 705
            G   P C E   PTPKCV  C  KN     +   KH   +AY +    E I  EI  NGP+EV+FTVYEDF  Y  GVY H  G  +GGHAVK++GWG  D+G  YW++AN WN +WG  GYF+I RG NECGIE   VAG+P
Sbjct:  197 GVKWPACPEDTEPTPKCVDSCTSKNNYATPYLQDKHFGSTAYAVGKKVEQIQTEILTNGPIEVAFTVYEDFYQYTTGVYVHTAGASLGGHAVKILGWGV-DNGTPYWLVANSWNVAWGEKGYFRIIRGLNECGIEHSAVAGIP 338          
BLAST of CB290207 vs. ExPASy Swiss-Prot
Match: CATB_BOVIN (Cathepsin B OS=Bos taurus GN=CTSB PE=1 SV=5)

HSP 1 Score: 155.221 bits (391), Expect = 3.246e-37
Identity = 66/138 (47.83%), Postives = 96/138 (69.57%), Query Frame = -2
Query:  289 SHPGCEPAYPTPKCVRKCVKK-NQLWRNSKHSSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKFGVYKHIPGDVMGGHAVKLIGWGTSDDGEDYWILANQWNRSWGADGYFKIKRGSNECGIEEDVVAGLP 699
            S P C     TPKC + C    +  ++  KH   S+Y + ++ ++IMAEIYKNGPVE +F+VY DF  YK GVY+H+ G++MGGHA++++GWG  ++G  YW++ N WN  WG +G+FKI RG + CGIE ++VAG+P
Sbjct:  194 SRPPCTGEGDTPKCSKTCEPGYSPSYKEDKHFGCSSYSVANNEKEIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVSGEIMGGHAIRILGWGV-ENGTPYWLVGNSWNTDWGDNGFFKILRGQDHCGIESEIVAGMP 330          
BLAST of CB290207 vs. ExPASy Swiss-Prot
Match: CPR4_CAEEL (Cathepsin B-like cysteine proteinase 4 OS=Caenorhabditis elegans GN=cpr-4 PE=2 SV=1)

HSP 1 Score: 154.451 bits (389), Expect = 5.537e-37
Identity = 71/138 (51.45%), Postives = 90/138 (65.22%), Query Frame = -2
Query:  289 PGC-EPAYPTPKCVRKCVKKNQ--LWRNSKHSSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKFGVYKHIPGDVMGGHAVKLIGWGTSDDGEDYWILANQWNRSWGADGYFKIKRGSNECGIEEDVVAGLP 693
            P C +  Y TP CV KC  KN    +   KH   +AY +      I AEI  +GPVE +FTVYEDF  YK GVY H  G  +GGHA++++GWGT D+G  YW++AN WN +WG +GYF+I RG+NECGIE  VV G+P
Sbjct:  197 PSCPDDGYDTPACVNKCTNKNYNVAYTADKHFGSTAYAVGKKVSQIQAEIIAHGPVEAAFTVYEDFYQYKTGVYVHTTGQELGGHAIRILGWGT-DNGTPYWLVANSWNVNWGENGYFRIIRGTNECGIEHAVVGGVP 333          
BLAST of CB290207 vs. ExPASy Swiss-Prot
Match: CYSP_SCHMA (Cathepsin B-like cysteine proteinase OS=Schistosoma mansoni PE=2 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 1.364e-35
Identity = 69/156 (44.23%), Postives = 95/156 (60.90%), Query Frame = -2
Query:  295 SHPGCEP--------------------AYPTPKCVRKCVKKNQL-WRNSKHSSISAYRINSDPEDIMAEIYKNGPVEVSFTVYEDFAHYKFGVYKHIPGDVMGGHAVKLIGWGTSDDGEDYWILANQWNRSWGADGYFKIKRGSNECGIEEDVVAG 699
            +H GCEP                     Y TP+C + C +K +  +   KH   S+Y + +D + I  EI K GPVE SFTVYEDF +YK G+YKHI G+ +GGHA+++IGWG  ++   YW++AN WN  WG +GYF+I RG +EC IE +V+AG
Sbjct:  183 NHTGCEPYPFPKCEHHTKGKYPPCGSKIYNTPRCKQTCQRKYKTPYTQDKHRGKSSYNVKNDEKAIQKEIMKYGPVEASFTVYEDFLNYKSGIYKHITGEALGGHAIRIIGWGV-ENKTPYWLIANSWNEDWGENGYFRIVRGRDECSIESEVIAG 337          
The following BLAST results are available for this feature:
BLAST of CB290207 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 57
Match NameE-valueIdentityDescription
CATB_RAT3.835e-3849.65Cathepsin B OS=Rattus norvegicus GN=Ctsb PE=1 SV=2[more]
CATB_PIG3.835e-3850.00Cathepsin B OS=Sus scrofa GN=CTSB PE=1 SV=1[more]
CATB_MACFA6.541e-3846.94Cathepsin B OS=Macaca fascicularis GN=CTSB PE=2 SV... [more]
CATB_HUMAN6.541e-3846.94Cathepsin B OS=Homo sapiens GN=CTSB PE=1 SV=3[more]
CATB_PONAB8.542e-3846.94Cathepsin B OS=Pongo abelii GN=CTSB PE=2 SV=1[more]
CATB_MOUSE1.903e-3749.28Cathepsin B OS=Mus musculus GN=Ctsb PE=1 SV=2[more]
CPR5_CAEEL2.485e-3751.75Cathepsin B-like cysteine proteinase 5 OS=Caenorha... [more]
CATB_BOVIN3.246e-3747.83Cathepsin B OS=Bos taurus GN=CTSB PE=1 SV=5[more]
CPR4_CAEEL5.537e-3751.45Cathepsin B-like cysteine proteinase 4 OS=Caenorha... [more]
CYSP_SCHMA1.364e-3544.23Cathepsin B-like cysteine proteinase OS=Schistosom... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS01_01aa10_b1 Washington Navel orange cold acclimated flavedo & albedo cDNA library Citrus sinensis cDNA clone UCRCS01_01aa10, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB290207 ID=CB290207|Name=CB290207|organism=Citrus sinensis|type=EST|length=724bp
AAAGATGCGACATTTTTCAACTAAACGAATAATTCGGGGAGGAGAAACCA
AGTTATTACAACTGGTTCTATTTTTACACCCAACATTAAACTCCATTAAT
ACATTCAATTATGCAAGACGGGAGCTTCCCATTTCATGCCTTGATAGCTT
AGGTTCAACGATACACCCCTATAGCTACACATTTGATATATAAATAACAA
CATGAAGGGATAGCAAAGTCTGCTCTCAAGCTGAAGCATCCTCAAACATA
TCTGCACTTGTAATCTCTTTGACAAGATTTTTGGATGAAGGCAAACCAGC
AACCACATCCTCTTCAATACCACACTCATTTGATCCTCTTTTAATCTTGA
AGTAACCATCCGCACCCCAGCTTCTATTCCACTGATTAGCGAGAATCCAG
TAATCCTCGCCATCATCACTAGTTCCCCAACCAATAAGCTTAACAGCATG
ACCCCCCATTACATCGCCTGGGATGTGTTTGTAAACCCCAAATTTGTAGT
GAGCAAAATCCTCATAAACTGTGAAGGAAACTTCAACTGGTCCATTCTTG
TAAATTTCTGCCATTATGTCCTCTGGATCAGAATTGATTCTATATGCACT
AATACTGGAGTGCTTTGAATTCCTCCAAAGCTGGTTTTTCTTGACGCACT
TCCTCACACACTTTGGAGTAGGATATGCCGGCTCACAACCAGGGTGGGAA
CAGCCAGTACTATCAAAGTAGGGA
back to top