CB290274

Overview
NameCB290274
Unique NameCB290274
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length744
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2896 contig Csv1_Contig2896:1..712. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB290274 vs. ExPASy Swiss-Prot
Match: PDXK_ARATH (Pyridoxal kinase OS=Arabidopsis thaliana GN=PK PE=1 SV=2)

HSP 1 Score: 375.17 bits (962), Expect = 2.106e-103
Identity = 184/209 (88.04%), Postives = 197/209 (94.26%), Query Frame = 1
Query:  118 PPILSLALPSETGRVLSIQSHTVQGYVGNKSAVFPLQLLGYDVDPIHSVQFSNHTGYPTFKGQVLNGQQLCDLIEGLEANNLLYYTHLLTGYIGSVSFLNTILQVVEKLRSINPNLIYVCDPVMGDEGKLYVPSELVSVYREKVVPVASMLTPNQFEAEQLTGFRIGSEADGREACKILHAAGPAKVVITSINIDGNLFLIGSHQKEKG 744
            PP+LSLALPS+TGRVLSIQSHTVQGYVGNKSAVFPLQLLGYDVDPI+SVQFSNHTGYPTFKGQVLNGQQLCDLIEGLEAN+LL+YTH+LTGYIGSVSFL+TIL+V+ KLRS+NPNL YVCDPVMGDEGKLYVP ELV VYREKVVP+ASMLTPNQFEAE+LTG RI SE DGREAC ILHAAGP+KVVITSI I G L LIGSHQKEKG
Sbjct:    4 PPVLSLALPSDTGRVLSIQSHTVQGYVGNKSAVFPLQLLGYDVDPINSVQFSNHTGYPTFKGQVLNGQQLCDLIEGLEANDLLFYTHVLTGYIGSVSFLDTILEVINKLRSVNPNLTYVCDPVMGDEGKLYVPEELVHVYREKVVPLASMLTPNQFEAEKLTGLRINSEEDGREACAILHAAGPSKVVITSITIGGILLLIGSHQKEKG 212          
BLAST of CB290274 vs. ExPASy Swiss-Prot
Match: PDXK_SHEEP (Pyridoxal kinase OS=Ovis aries GN=PDXK PE=1 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 4.303e-56
Identity = 107/188 (56.91%), Postives = 142/188 (75.53%), Query Frame = 1
Query:  148 ETGRVLSIQSHTVQGYVGNKSAVFPLQLLGYDVDPIHSVQFSNHTGYPTFKGQVLNGQQLCDLIEGLEANNLLYYTHLLTGYIGSVSFLNTILQVVEKLRSINPNLIYVCDPVMGD----EGKLYVPSELVSVYREKVVPVASMLTPNQFEAEQLTGFRIGSEADGREACKILHAAGPAKVVITSINI 699
            E  RVLSIQSH V+GYVGN++A FPLQ+LG++VD ++SVQFSNHTGY  +KGQVLN  +L +L +GL+ N++  Y ++LTGY    SFL  ++ +V++L+  NP L+YVCDPVMGD    EG +YVP +L+ VYREKVVPVA ++TPNQFEAE LTG +I S+ +  E   +LH+ GP  VVITS N+
Sbjct:    3 EECRVLSIQSHVVRGYVGNRAATFPLQVLGFEVDAVNSVQFSNHTGYSHWKGQVLNSDELQELYDGLKLNHVNQYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVMGDQRNGEGAMYVPDDLLPVYREKVVPVADIITPNQFEAELLTGRKIHSQEEALEVMDMLHSMGPDTVVITSSNL 190          
BLAST of CB290274 vs. ExPASy Swiss-Prot
Match: PDXK_PIG (Pyridoxal kinase OS=Sus scrofa GN=PDXK PE=1 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 4.303e-56
Identity = 109/185 (58.92%), Postives = 138/185 (74.59%), Query Frame = 1
Query:  157 RVLSIQSHTVQGYVGNKSAVFPLQLLGYDVDPIHSVQFSNHTGYPTFKGQVLNGQQLCDLIEGLEANNLLYYTHLLTGYIGSVSFLNTILQVVEKLRSINPNLIYVCDPVMGD----EGKLYVPSELVSVYREKVVPVASMLTPNQFEAEQLTGFRIGSEADGREACKILHAAGPAKVVITSINI 699
            RVLSIQSH V+GYVGN++A FPLQ+LG++VD ++SVQFSNHTGY  +KGQVLN  +L  L EGL+ NN+  Y ++LTGY    SFL  ++ +V +L+  NP L+YVCDPVMGD    EG +YVP +L+ VYREKVVPVA ++TPNQFEAE LTG RI SE +      +LHA GP  VVITS ++
Sbjct:   16 RVLSIQSHVVRGYVGNRAATFPLQVLGFEVDAVNSVQFSNHTGYAHWKGQVLNSDELHALYEGLKLNNVNQYDYVLTGYTRDKSFLAMVVDIVRELKQQNPRLVYVCDPVMGDKWDGEGSMYVPEDLLPVYREKVVPVADIITPNQFEAELLTGRRIHSEEEALAVMDMLHAMGPDTVVITSSDL 200          
BLAST of CB290274 vs. ExPASy Swiss-Prot
Match: PDXK_BOVIN (Pyridoxal kinase OS=Bos taurus GN=PDXK PE=2 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 3.642e-55
Identity = 105/188 (55.85%), Postives = 142/188 (75.53%), Query Frame = 1
Query:  148 ETGRVLSIQSHTVQGYVGNKSAVFPLQLLGYDVDPIHSVQFSNHTGYPTFKGQVLNGQQLCDLIEGLEANNLLYYTHLLTGYIGSVSFLNTILQVVEKLRSINPNLIYVCDPVMGD----EGKLYVPSELVSVYREKVVPVASMLTPNQFEAEQLTGFRIGSEADGREACKILHAAGPAKVVITSINI 699
            E  RVLSIQSH V+GYVGN++A FPLQ+LG++VD ++SVQFSNHTGY  +KGQVLN  +L +L +GL+ N++  Y ++LTGY    SFL  ++ +V++L+  NP L+YVCDPVMGD    EG +YVP +L+ VYREKVVPVA ++TPNQFEAE LTG +I ++ +  E   +LH+ GP  VVITS ++
Sbjct:    3 EECRVLSIQSHVVRGYVGNRAATFPLQVLGFEVDAVNSVQFSNHTGYSHWKGQVLNSDELQELYDGLKLNSVNQYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVMGDQRDGEGAMYVPDDLLPVYREKVVPVADIITPNQFEAELLTGRKIHTQEEALEVMDMLHSMGPDTVVITSSDL 190          
BLAST of CB290274 vs. ExPASy Swiss-Prot
Match: PDXK_HUMAN (Pyridoxal kinase OS=Homo sapiens GN=PDXK PE=1 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 2.361e-54
Identity = 104/205 (50.73%), Postives = 147/205 (71.71%), Query Frame = 1
Query:  148 ETGRVLSIQSHTVQGYVGNKSAVFPLQLLGYDVDPIHSVQFSNHTGYPTFKGQVLNGQQLCDLIEGLEANNLLYYTHLLTGYIGSVSFLNTILQVVEKLRSINPNLIYVCDPVMGD----EGKLYVPSELVSVYREKVVPVASMLTPNQFEAEQLTGFRIGSEADGREACKILHAAGPAKVVITSINI-----DGNLFLIGSHQK 735
            E  RVLSIQSH ++GYVGN++A FPLQ+LG+++D ++SVQFSNHTGY  +KGQVLN  +L +L EGL  NN+  Y ++LTGY    SFL  ++ +V++L+  NP L+YVCDPV+GD    EG +YVP +L+ VY+EKVVP+A ++TPNQFEAE L+G +I S+ +      +LH+ GP  VVITS ++        L ++GS ++
Sbjct:    3 EECRVLSIQSHVIRGYVGNRAATFPLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNKYDYVLTGYTRDKSFLAMVVDIVQELKQQNPRLVYVCDPVLGDKWDGEGSMYVPEDLLPVYKEKVVPLADIITPNQFEAELLSGRKIHSQEEALRVMDMLHSMGPDTVVITSSDLPSPQGSNYLIVLGSQRR 207          
BLAST of CB290274 vs. ExPASy Swiss-Prot
Match: PDXK_RAT (Pyridoxal kinase OS=Rattus norvegicus GN=Pdxk PE=1 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 3.083e-54
Identity = 108/204 (52.94%), Postives = 145/204 (71.08%), Query Frame = 1
Query:  157 RVLSIQSHTVQGYVGNKSAVFPLQLLGYDVDPIHSVQFSNHTGYPTFKGQVLNGQQLCDLIEGLEANNLLYYTHLLTGYIGSVSFLNTILQVVEKLRSINPNLIYVCDPVMGD----EGKLYVPSELVSVYREKVVPVASMLTPNQFEAEQLTGFRIGSEADGREACKILHAAGPAKVVITSINI-----DGNLFLIGSHQKEK 741
            RVLSIQSH V+GYVGN++A+FPLQ+LG++VD ++SVQFSNHTGY  +KGQVL  Q+L  L EGL+ANN+  Y ++LTGY    SFL  ++ +V++L+  N  L+YVCDPVMGD    EG +YVP +L+ VYREKVVP+A ++TPNQFEAE L+G +I S+ +      +LH  GP  VVITS ++        L  +GS +  K
Sbjct:    6 RVLSIQSHVVRGYVGNRAAMFPLQVLGFEVDAVNSVQFSNHTGYAHWKGQVLTSQELHALYEGLKANNVNKYDYVLTGYTRDKSFLGMVVDIVQELKQQNSRLVYVCDPVMGDKWNGEGSMYVPQDLLPVYREKVVPMADIITPNQFEAELLSGRKIHSQEEAFAVMDVLHRMGPDTVVITSSDLPSPKGSDYLMALGSQRMRK 209          
BLAST of CB290274 vs. ExPASy Swiss-Prot
Match: PDXK_MOUSE (Pyridoxal kinase OS=Mus musculus GN=Pdxk PE=1 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 4.027e-54
Identity = 107/204 (52.45%), Postives = 146/204 (71.57%), Query Frame = 1
Query:  157 RVLSIQSHTVQGYVGNKSAVFPLQLLGYDVDPIHSVQFSNHTGYPTFKGQVLNGQQLCDLIEGLEANNLLYYTHLLTGYIGSVSFLNTILQVVEKLRSINPNLIYVCDPVMGD----EGKLYVPSELVSVYREKVVPVASMLTPNQFEAEQLTGFRIGSEADGREACKILHAAGPAKVVITSINIDGN-----LFLIGSHQKEK 741
            RVLSIQSH V+GYVGN++A+FPLQ+LG++VD ++SVQFSNHTGY  +KGQVL  Q+L +L EGL+ N++  Y ++LTGY    SFL  ++ +V +L+  N  L+YVCDPVMGD    EG +YVP +L+ VYR+KVVPVA ++TPNQFEAE L+G +I S+ +  E   +LH  GP  VVITS ++  +     L  +GS +  K
Sbjct:    6 RVLSIQSHVVRGYVGNRAAMFPLQVLGFEVDAVNSVQFSNHTGYAHWKGQVLKSQELHELYEGLKVNDVNKYDYVLTGYTRDKSFLAMVVDIVRELKQQNSRLVYVCDPVMGDKWNGEGSMYVPQDLLPVYRDKVVPVADIITPNQFEAELLSGRKIHSQEEAFEVMDMLHCMGPDTVVITSSDLPSSQGSDYLIALGSQRMRK 209          
BLAST of CB290274 vs. ExPASy Swiss-Prot
Match: PDXK_DICDI (Pyridoxal kinase OS=Dictyostelium discoideum GN=pykA PE=1 SV=1)

HSP 1 Score: 197.978 bits (502), Expect = 4.608e-50
Identity = 105/194 (54.12%), Postives = 135/194 (69.59%), Query Frame = 1
Query:  157 RVLSIQSHTVQGYVGNKSAVFPLQLLGYDVDPIHSVQFSNHTGYPTFKGQVLNGQQLCDLIEGLEANNLLY-YTHLLTGYIGSVSFLNTILQVVEKLRSINPNLIYVCDPVMGDEGKLYVPSELVSVYREKVVPVASMLTPNQFEAEQLTGFRIGSEADGREACKILHAAGPAKVVITSINIDGN---LFLIGS 726
            +VLSIQS    GYVGNK AVF LQ LG +VDPI+SV  SN+T YPT+KG+ L   +L DL +GLE N+L   YTH+LTGY  SV  L+T+L++V+KL+S NPNLIYVCDPV+GD  +LYVP +LV VY+ +V+P A  + PNQ E E LTG +I ++ D  +A    H  G   VVITS+  D N   + +IGS
Sbjct:    4 KVLSIQSWVCHGYVGNKCAVFALQHLGIEVDPINSVHLSNNTAYPTWKGESLTPNKLGDLFQGLEDNHLTSNYTHVLTGYNNSVQTLHTVLKIVKKLKSENPNLIYVCDPVLGDNNELYVPEDLVEVYKNEVIPNADYIFPNQTEVEFLTGIKIKNDQDALKAIDQFHKMGVKNVVITSLFFDTNPNDIIVIGS 197          
BLAST of CB290274 vs. ExPASy Swiss-Prot
Match: PDXK_CAEEL (Putative pyridoxal kinase OS=Caenorhabditis elegans GN=F57C9.1 PE=2 SV=2)

HSP 1 Score: 189.119 bits (479), Expect = 2.140e-47
Identity = 100/188 (53.19%), Postives = 124/188 (65.96%), Query Frame = 1
Query:  157 RVLSIQSHTVQGYVGNKSAVFPLQLLGYDVDPIHSVQFSNHTG----------YPTFKGQVLNGQQLCDLIEGLEANNLLYYTHLLTGYIGSVSFLNTILQVVEKLRSINPNLIYVCDPVMGDEGKLYVPSELVSVYREKVVPVASMLTPNQFEAEQLTGFRIGSEADGREACKILHAAGPAKVVITS 690
            RVLSIQSH V GY GNK +VFPLQL G++VD I+SVQFSNH G          Y   KGQ L  ++L +L EGL  NN+  YTH+LTGY G+V+FL  I  VV+ L+  N N  +VCDPVMGD G+ Y P EL+ VYR+ ++P+A +LTPN FE  +LTG  I +E D   A   LHA G   VV+TS
Sbjct:   17 RVLSIQSHVVHGYAGNKCSVFPLQLHGFEVDFINSVQFSNHAGNIEYLTLPTRYEHVKGQKLTEKELEELYEGLTLNNINNYTHVLTGYCGNVTFLQKIADVVKDLKKKNGNTTFVCDPVMGDNGRYYTPKELMPVYRDLIIPLADVLTPNAFELGELTGSPIETEEDCLRAVNELHAKGVKTVVVTS 204          
BLAST of CB290274 vs. ExPASy Swiss-Prot
Match: YELB_SCHPO (Putative pyridoxal kinase C6F6.11c OS=Schizosaccharomyces pombe GN=SPAC6F6.11c PE=2 SV=2)

HSP 1 Score: 159.073 bits (401), Expect = 2.372e-38
Identity = 86/197 (43.65%), Postives = 124/197 (62.94%), Query Frame = 1
Query:  151 TGRVLSIQSHTVQGYVGNKSAVFPLQLLGYDVDPIHSVQFSNHTGYPTFKGQVLNGQQLCDLIEGLEANNLLYYTHLLTGYIGSVSFLNTILQVVEKLRSINPNLIYVCDPVMGDEGKLYVPSELVSVYREKVVPVASMLTPNQFEAEQLTGFRIGSEADGREACKILHAAGPA-KVVITSINIDGN----LFLIGS 726
            T R+L+IQS    GYVGN++A FPLQLLG+DVD I +V+ SNH GYP  KG+ L+ +Q+ DL +G+ A N   Y  LLTGY   +  +  I+++V  ++S N    +V DPV+GD G+LYV   ++ +YRE ++P A ++TPN FEAE L+G RI S     +  + L       +VVI+S  ++ N    L+ IGS
Sbjct:    4 TKRILAIQSSVCHGYVGNRAATFPLQLLGWDVDAIPTVELSNHAGYPIVKGRTLSAEQILDLYKGVSAANPSGYECLLTGYARGIGSVKAIMEIVRSVKSKNKKAFWVFDPVLGDNGRLYVEESIIPLYRE-MLPFADLITPNGFEAEILSGMRINSIDTAFKCVECLQQKYKVPRVVISSFVVEENGVEKLYCIGS 199          
The following BLAST results are available for this feature:
BLAST of CB290274 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 112
Match NameE-valueIdentityDescription
PDXK_ARATH2.106e-10388.04Pyridoxal kinase OS=Arabidopsis thaliana GN=PK PE=... [more]
PDXK_SHEEP4.303e-5656.91Pyridoxal kinase OS=Ovis aries GN=PDXK PE=1 SV=1[more]
PDXK_PIG4.303e-5658.92Pyridoxal kinase OS=Sus scrofa GN=PDXK PE=1 SV=1[more]
PDXK_BOVIN3.642e-5555.85Pyridoxal kinase OS=Bos taurus GN=PDXK PE=2 SV=1[more]
PDXK_HUMAN2.361e-5450.73Pyridoxal kinase OS=Homo sapiens GN=PDXK PE=1 SV=1[more]
PDXK_RAT3.083e-5452.94Pyridoxal kinase OS=Rattus norvegicus GN=Pdxk PE=1... [more]
PDXK_MOUSE4.027e-5452.45Pyridoxal kinase OS=Mus musculus GN=Pdxk PE=1 SV=1[more]
PDXK_DICDI4.608e-5054.12Pyridoxal kinase OS=Dictyostelium discoideum GN=py... [more]
PDXK_CAEEL2.140e-4753.19Putative pyridoxal kinase OS=Caenorhabditis elegan... [more]
YELB_SCHPO2.372e-3843.65Putative pyridoxal kinase C6F6.11c OS=Schizosaccha... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS01_01ae04_g1 Washington Navel orange cold acclimated flavedo & albedo cDNA library Citrus sinensis cDNA clone UCRCS01_01ae04, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB290274 ID=CB290274|Name=CB290274|organism=Citrus sinensis|type=EST|length=744bp
GCCCTTAGGAGTTGCCGTCCTTGTTTGGGCACTTCCCGAAACCTCACGTT
TTCCGGCTTGATAGCAGCTTCCGATTGGATTTGTAGGAGGAGAAGCTCGA
GCATATCAGGAATGGCGCCTCCGATTCTCTCATTGGCTTTACCTTCGGAG
ACTGGTCGAGTTTTGAGCATACAGTCGCATACTGTTCAGGGGTATGTTGG
AAATAAATCAGCTGTCTTTCCTCTCCAACTACTGGGCTATGACGTGGATC
CAATCCATTCAGTACAGTTCTCAAACCACACAGGATACCCAACTTTCAAG
GGCCAAGTTTTGAATGGACAACAATTATGCGACTTAATAGAAGGACTGGA
AGCCAATAATCTATTGTACTATACTCATTTATTAACAGGTTATATTGGTT
CTGTTTCTTTTCTGAACACGATACTGCAAGTTGTTGAAAAGCTTCGCTCT
ATAAACCCAAATCTGATATACGTTTGTGATCCAGTGATGGGTGACGAGGG
AAAGCTCTATGTTCCTTCCGAGCTAGTATCAGTATACCGTGAGAAGGTTG
TTCCAGTGGCCTCAATGTTGACCCCTAATCAGTTTGAAGCAGAACAGTTG
ACTGGTTTCAGGATTGGGAGTGAAGCAGATGGGAGGGAAGCTTGTAAGAT
TCTTCATGCTGCTGGACCTGCAAAGGTTGTGATCACAAGCATAAATATAG
ATGGCAATCTTTTCCTGATTGGCAGTCATCAGAAGGAAAAGGGT
back to top