CB290279

Overview
NameCB290279
Unique NameCB290279
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length855
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB290279 vs. ExPASy Swiss-Prot
Match: RAB7_PEA (Ras-related protein Rab7 OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 379.407 bits (973), Expect = 1.388e-104
Identity = 181/191 (94.76%), Postives = 190/191 (99.48%), Query Frame = -2
Query:  282 DSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPDNFPFVVLGNKIDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGINVEEAFQCIAKNALKSGEEEEIYLPDTIDVGNSSQPRSSGCEC 854
            DSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNS+KSFDNLNNWREEFLIQA+PSDP+NFPFVV+GNKID+DGGNSRVVSEKKARAWCA+KGNIPYFETSAKEGINVEEAFQ IAK+ALKSGEEEE+YLPDTIDVGNSSQPRS+GCEC
Sbjct:   16 DSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNSVKSFDNLNNWREEFLIQANPSDPENFPFVVIGNKIDIDGGNSRVVSEKKARAWCAAKGNIPYFETSAKEGINVEEAFQTIAKDALKSGEEEELYLPDTIDVGNSSQPRSTGCEC 206          
BLAST of CB290279 vs. ExPASy Swiss-Prot
Match: RAB7_PRUAR (Ras-related protein Rab7 OS=Prunus armeniaca PE=2 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 1.942e-98
Identity = 174/192 (90.62%), Postives = 182/192 (94.79%), Query Frame = -2
Query:  282 DSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPDNFPFVVLGNKIDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGINVEEAFQCIAKNALKSGEEEEIYLPDTIDV-GNSSQPRSSGCEC 854
            DSGVGKTSLMNQYVN+KFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVN MKSF+NLNNWREEFLIQA+PSDP+NFPFVVLGNKIDVDGGNSRVVSEKKA+AWCASKGNIPYFETSAKEG NV++AFQCIAKNAL +  EEEIYLPDTIDV G   Q RSSGCEC
Sbjct:   16 DSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFENLNNWREEFLIQATPSDPENFPFVVLGNKIDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVDDAFQCIAKNALNNEPEEEIYLPDTIDVAGGGRQQRSSGCEC 207          
BLAST of CB290279 vs. ExPASy Swiss-Prot
Match: RAB7_CENCI (Ras-related protein Rab7 OS=Cenchrus ciliaris PE=2 SV=1)

HSP 1 Score: 356.681 bits (914), Expect = 9.636e-98
Identity = 172/190 (90.53%), Postives = 181/190 (95.26%), Query Frame = -2
Query:  288 DSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPDNFPFVVLGNKIDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGINVEEAFQCIAKNALKSGEEEEIYLPDTID-VGNSSQPRSSGC 854
            DSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPDNFPFV+LGNK+DVDGGNSRVVSEKKA+AWCASKGNIPYFETSAKEG NVE+AFQCI KNALK+  EEE+Y+PDT+D VG +   RSSGC
Sbjct:   16 DSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPDNFPFVLLGNKVDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGTNVEDAFQCIVKNALKNEPEEELYVPDTVDVVGGNRAQRSSGC 205          
BLAST of CB290279 vs. ExPASy Swiss-Prot
Match: RAB7_GOSHI (Ras-related protein Rab7 OS=Gossypium hirsutum GN=RAB7 PE=2 SV=1)

HSP 1 Score: 353.984 bits (907), Expect = 6.246e-97
Identity = 169/192 (88.02%), Postives = 183/192 (95.31%), Query Frame = -2
Query:  282 DSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPDNFPFVVLGNKIDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGINVEEAFQCIAKNALKSGEEEEIYLPDTIDVGNSSQP-RSSGCEC 854
            DSGVGKTSLMNQYVN+KFSNQYKATIGADFLTKEVQF+DRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLV+DVN MKSFDNLNNWREEFLIQASPSDP+NFPFVVLGNK+DVDGGNSRVVSEKKA+AWCASKGNIPYFETSAKEG NV+ AF+CIA+NALK+  EEEIYLP+TIDV +  +P RS+GCEC
Sbjct:   16 DSGVGKTSLMNQYVNRKFSNQYKATIGADFLTKEVQFDDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVHDVNVMKSFDNLNNWREEFLIQASPSDPENFPFVVLGNKVDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVDAAFECIARNALKNEPEEEIYLPETIDVASGGRPQRSTGCEC 207          
BLAST of CB290279 vs. ExPASy Swiss-Prot
Match: RAB7_MESCR (Ras-related protein Rab7A OS=Mesembryanthemum crystallinum PE=2 SV=1)

HSP 1 Score: 341.658 bits (875), Expect = 3.208e-93
Identity = 163/192 (84.90%), Postives = 179/192 (93.23%), Query Frame = -2
Query:  282 DSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPDNFPFVVLGNKIDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGINVEEAFQCIAKNALKSGEEEEIYLPDTIDVGNSSQPR-SSGCEC 854
            DSGVGKTSLMNQ+VNKKFSNQYKATIGADFLTKE+QFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVL YDVN MKSF++LN WREEFLIQASP+DPDNFPFV+LGNKIDVDGG+ RVVSEKKA+AWC SKGNIPYFETSAK+G NVEEAFQCIAKNA+++  EEE YLPDTID+  S++P+ SS CEC
Sbjct:   16 DSGVGKTSLMNQFVNKKFSNQYKATIGADFLTKELQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLTYDVNVMKSFESLNRWREEFLIQASPADPDNFPFVLLGNKIDVDGGSGRVVSEKKAKAWCMSKGNIPYFETSAKDGTNVEEAFQCIAKNAIQNEPEEETYLPDTIDMAGSTRPQSSSACEC 207          
BLAST of CB290279 vs. ExPASy Swiss-Prot
Match: YPTC5_CHLRE (GTP-binding protein YPTC5 OS=Chlamydomonas reinhardtii GN=YPTC5 PE=3 SV=1)

HSP 1 Score: 296.975 bits (759), Expect = 9.061e-80
Identity = 137/190 (72.11%), Postives = 168/190 (88.42%), Query Frame = -2
Query:  288 DSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPDNFPFVVLGNKIDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGINVEEAFQCIAKNALKSGEEEEIYLPDTIDVG-NSSQPRSSGC 854
            DSGVGKTSLMNQYV KKF+ +YKATIGADFLTKE++ +D+  T+QIWDTAGQERFQSLG AFYRGADCCVLV+DVN+ KSFD+L+NWR+EF+IQA P DPDNFPF+VLGNKID +GG+SR VSEKKA+AWCASKG+IPYFETSAKE INVE AF CI +NAL++ +EEE+++PD +D+   ++Q + +GC
Sbjct:   16 DSGVGKTSLMNQYVQKKFTKEYKATIGADFLTKEIEVDDKKVTMQIWDTAGQERFQSLGSAFYRGADCCVLVFDVNNAKSFDDLDNWRDEFIIQAGPPDPDNFPFMVLGNKIDENGGSSRQVSEKKAKAWCASKGSIPYFETSAKEDINVEAAFTCITRNALRNEKEEELFMPDAVDMNTTATQRKRAGC 205          
BLAST of CB290279 vs. ExPASy Swiss-Prot
Match: RAB7_VIGAC (Ras-related protein Rab7 OS=Vigna aconitifolia PE=2 SV=1)

HSP 1 Score: 293.893 bits (751), Expect = 7.670e-79
Identity = 140/191 (73.30%), Postives = 158/191 (82.72%), Query Frame = -2
Query:  282 DSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPDNFPFVVLGNKIDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGINVEEAFQCIAKNALKSGEEEEIYLPDTIDVGNSSQPRSSGCEC 854
            D+GVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +DRL TLQIWDTAGQERFQSLGVAFYRGADCCVL YDVN MKSFD L+NW EEFL QA+P DP +FPF++LGNKID+DGGNSRVVSEKKA+ WCASKGNIPYFETSAKE  NV+ AF CIAK AL +  E++IY     +       + SGC C
Sbjct:   16 DTGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQIWDTAGQERFQSLGVAFYRGADCCVLAYDVNVMKSFDTLDNWHEEFLKQANPPDPRSFPFILLGNKIDIDGGNSRVVSEKKAKDWCASKGNIPYFETSAKEDFNVDAAFLCIAKAALANEHEQDIYFQGIPEAAVPENEQRSGCAC 206          
BLAST of CB290279 vs. ExPASy Swiss-Prot
Match: RAB7_SOYBN (Ras-related protein Rab7 OS=Glycine max PE=2 SV=1)

HSP 1 Score: 293.508 bits (750), Expect = 1.002e-78
Identity = 141/191 (73.82%), Postives = 157/191 (82.20%), Query Frame = -2
Query:  282 DSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPDNFPFVVLGNKIDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGINVEEAFQCIAKNALKSGEEEEIYLPDTIDVGNSSQPRSSGCEC 854
            DSGVGKTSLMNQYV+KKFS QYKATIGADF+TKE+Q +DRL TLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVN MKSFD L NW EEFL QA+P DP  FPF++LGNKID+DGGNSRVVSEKKA+ WCA+KGNIPYFETSAKE  NV+ AF CIAK AL +  E++IY     +       + SGC C
Sbjct:   16 DSGVGKTSLMNQYVHKKFSQQYKATIGADFVTKELQIDDRLVTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNVMKSFDTLENWHEEFLKQANPPDPRAFPFILLGNKIDIDGGNSRVVSEKKAKDWCAAKGNIPYFETSAKEDYNVDAAFLCIAKAALANEHEQDIYFQGIPEAAVPENEQRSGCAC 206          
BLAST of CB290279 vs. ExPASy Swiss-Prot
Match: YPTV5_VOLCA (GTP-binding protein yptV5 OS=Volvox carteri GN=YPTV5 PE=3 SV=1)

HSP 1 Score: 290.041 bits (741), Expect = 1.108e-77
Identity = 137/191 (71.73%), Postives = 164/191 (85.86%), Query Frame = -2
Query:  282 DSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPDNFPFVVLGNKIDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGINVEEAFQCIAKNALKSGEEEEIYLPDTIDVGNSSQPRSSGCEC 854
            DSGVGKTSLMNQYV KKF+ +YKATIGADFLTKE++ +D+  T+QIWDTAGQERFQSLG AFYRGADCC+LV+DVN+ KSFD+L+NWR+EF+IQA PSDPDNFPFVVLGNKID  G N R V+EKKA+AWCASKG+IPYFETSAKE INVE AF CI +NAL++ +EEE+++PD +D+  S+  R  G  C
Sbjct:   16 DSGVGKTSLMNQYVQKKFTKEYKATIGADFLTKEIEVDDKKVTMQIWDTAGQERFQSLGSAFYRGADCCMLVFDVNNAKSFDDLDNWRDEFIIQAGPSDPDNFPFVVLGNKIDEVGVN-RQVTEKKAKAWCASKGSIPYFETSAKEDINVEAAFTCITRNALRNEKEEELFVPDAVDMNTSATQRKRGGCC 205          
BLAST of CB290279 vs. ExPASy Swiss-Prot
Match: RAB7A_DICDI (Ras-related protein Rab-7A OS=Dictyostelium discoideum GN=rab7A PE=1 SV=1)

HSP 1 Score: 285.804 bits (730), Expect = 2.089e-76
Identity = 139/189 (73.54%), Postives = 158/189 (83.60%), Query Frame = -2
Query:  288 DSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFDNLNNWREEFLIQASPSDPDNFPFVVLGNKIDVDGGNSRVVSEKKARAWCASKGNIPYFETSAKEGINVEEAFQCIAKNALKSGEEEEIYLPDTIDVGNSSQPRSSGC 854
            DSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKE+  +DR+ T+QIWDTAGQERFQSLGVAFYRGADCCVL YDVN  K+F+NL++WR+EFLIQA P DPDNFPFVVLGNKID++  N RVVS+K+A +WC SKGNIPYFETSAKE INVE+AFQ IA+NA+K  +     +P  I V    QP  SGC
Sbjct:   16 DSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKELMVDDRVVTMQIWDTAGQERFQSLGVAFYRGADCCVLCYDVNVAKTFENLDSWRDEFLIQAGPRDPDNFPFVVLGNKIDLE--NQRVVSQKRAASWCQSKGNIPYFETSAKEAINVEQAFQTIARNAIKLEDGLVFPIPTNIQVIPEPQPAKSGC 202          
The following BLAST results are available for this feature:
BLAST of CB290279 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
RAB7_PEA1.388e-10494.76Ras-related protein Rab7 OS=Pisum sativum PE=2 SV=... [more]
RAB7_PRUAR1.942e-9890.63Ras-related protein Rab7 OS=Prunus armeniaca PE=2 ... [more]
RAB7_CENCI9.636e-9890.53Ras-related protein Rab7 OS=Cenchrus ciliaris PE=2... [more]
RAB7_GOSHI6.246e-9788.02Ras-related protein Rab7 OS=Gossypium hirsutum GN=... [more]
RAB7_MESCR3.208e-9384.90Ras-related protein Rab7A OS=Mesembryanthemum crys... [more]
YPTC5_CHLRE9.061e-8072.11GTP-binding protein YPTC5 OS=Chlamydomonas reinhar... [more]
RAB7_VIGAC7.670e-7973.30Ras-related protein Rab7 OS=Vigna aconitifolia PE=... [more]
RAB7_SOYBN1.002e-7873.82Ras-related protein Rab7 OS=Glycine max PE=2 SV=1[more]
YPTV5_VOLCA1.108e-7771.73GTP-binding protein yptV5 OS=Volvox carteri GN=YPT... [more]
RAB7A_DICDI2.089e-7673.54Ras-related protein Rab-7A OS=Dictyostelium discoi... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS01_01ae07_b1 Washington Navel orange cold acclimated flavedo & albedo cDNA library Citrus sinensis cDNA clone UCRCS01_01ae07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB290279 ID=CB290279|Name=CB290279|organism=Citrus sinensis|type=EST|length=855bp
TTTTTTTTTTATAATCATAGAACATTAAGATTAAATCACGACCGGTCATC
AAGAAAGGAGGAAGAAAATAGCCCAGTGCAAGAACGAAACATAACACTTC
AAGCAGTAGTTACACAGAAGAACACAGACAACTAAAGGTAACTAGTAGGA
ATGAACCAATTTGTTTCACACAAACACTAATGTACAATGTAACCTTATAC
ATACCCATAAAAATGGTTAAAAAGGCCAAATCATTTGTTATACTGCTTAT
TGCTCCTTGAAAAAATTAGACCATATCTTTAGCACTCGCATCCACTTGAC
CTTGGCTGGCTGCTGTTACCAACATCAATGGTGTCCGGCAAGTATATCTC
TTCCTCCTCCCCACTCTTCAAAGCATTTTTAGCTATGCACTGGAAAGCTT
CTTCCACATTAATGCCTTCTTTTGCAGAGGTCTCAAAGTAAGGAATATTT
CCTTTGGAAGCACACCATGCTCGAGCCTTCTTCTCCGAAACCACCCTACT
GTTTCCACCATCTACATCAATCTTATTTCCTAAAACAACAAAGGGGAAAT
TGTCTGGATCCGAAGGGCTAGCCTGAATGAGGAATTCTTCTCTCCAGTTA
TTGAGGTTGTCAAAGGACTTCATAGAATTTACATCATACACAAGTACACA
GCAATCTGCACCTCGGTAGAAAGCAACACCCAGGCTTTGGAATCTTTCCT
GACCAGCTGTATCCCAGATCTGTAAGGTGAAGAGCCTATCTTCAAACTGC
ACTTCCTTTGTCAAGAAATCAGCTCCGATGGTCGCCTTGTACTGATTGCT
AAACTTCTTGTTTACATATTGATTCATCAAAGAGGTCTTGCCCACCCCGC
TGTCG
back to top