CB290282

Overview
NameCB290282
Unique NameCB290282
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length763
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB290282 vs. ExPASy Swiss-Prot
Match: EIN3_ARATH (Protein ETHYLENE INSENSITIVE 3 OS=Arabidopsis thaliana GN=EIN3 PE=1 SV=1)

HSP 1 Score: 425.246 bits (1092), Expect = 1.841e-118
Identity = 203/250 (81.20%), Postives = 215/250 (86.00%), Query Frame = 3
Query:   15 SAPLGDADM-PFQPSEPEAXXXXXXXXXXXXXXXLERRMWKDKMRLKRLKEQSRGKEGIDMAKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPAAIAKYQADNSVPGKNEGINAIGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVSPPWWPTGKEEWWPQLGLPKDQGAPPYKKPHDLKKAWKVGVLTAVIKHMSPDIAKI 761
            S  LG+ D  P   +EP++               LERRMW+DKMRLKRLKEQ +GKEG+D AKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPE GKPVTGASDNLREWWKDKVRFDRNGPAAI KYQA+N++PG +EG N IGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGV PPWWP GKE+WWPQLGLPKDQG  PYKKPHDLKKAWKVGVLTAVIKHM PDIAKI
Sbjct:   17 SGSLGEVDFCPVPQAEPDSIVEDDYTDDEIDVDELERRMWRDKMRLKRLKEQDKGKEGVDAAKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPENGKPVTGASDNLREWWKDKVRFDRNGPAAITKYQAENNIPGIHEGNNPIGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVPPPWWPNGKEDWWPQLGLPKDQGPAPYKKPHDLKKAWKVGVLTAVIKHMFPDIAKI 266          
BLAST of CB290282 vs. ExPASy Swiss-Prot
Match: EIL1_ARATH (ETHYLENE INSENSITIVE 3-like 1 protein OS=Arabidopsis thaliana GN=EIL1 PE=1 SV=1)

HSP 1 Score: 404.831 bits (1039), Expect = 2.574e-112
Identity = 192/218 (88.07%), Postives = 205/218 (94.04%), Query Frame = 3
Query:  114 LERRMWKDKMRLKRLKEQ-SRGKEGIDMAKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPAAIAKYQADNSVPGKNEGINA-IGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVSPPWWPTGKEEWWPQLGLPKDQGAPPYKKPHDLKKAWKVGVLTAVIKHMSPDIAKI 761
            LE+RMW+DKMRLKRLKEQ S+ KEG+D +KQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPAAIAKYQ++N++ G +   N+ +GPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVSPPWWP G EEWWPQLGLP +QG PPYKKPHDLKKAWKVGVLTAVIKHMSPDIAKI
Sbjct:   51 LEKRMWRDKMRLKRLKEQQSKCKEGVDGSKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPAAIAKYQSENNISGGSNDCNSLVGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVSPPWWPNGNEEWWPQLGLPNEQGPPPYKKPHDLKKAWKVGVLTAVIKHMSPDIAKI 268          
BLAST of CB290282 vs. ExPASy Swiss-Prot
Match: EIL3_ARATH (ETHYLENE INSENSITIVE 3-like 3 protein OS=Arabidopsis thaliana GN=EIL3 PE=1 SV=1)

HSP 1 Score: 316.235 bits (809), Expect = 1.204e-85
Identity = 151/218 (69.27%), Postives = 180/218 (82.57%), Query Frame = 3
Query:  114 LERRMWKDKMRLKRLKE-QSRGKEGIDMAKQ-RQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPAAIAKYQADNSVPGKNEGINAIGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVSPPWWPTGKEEWWPQLGLPKDQGAPPYKKPHDLKKAWKVGVLTAVIKHMSPDIAKI 761
            LERRMWKD++RLKR+KE Q  G +G    +  ++  +QA+RKKMSRAQDGILKYMLK+MEVCK +GFVYGIIPEKGKPV+G+SDN+R WWK+KV+FD+NGPAAIAKY+ +    GK++G      +   LQ+LQD TLGSLLS+LMQHCDPPQR++PLEKG  PPWWPTG EEWW +LGLPK Q +PPY+KPHDLKK WKVGVLTAVI HM PDIAKI
Sbjct:   40 LERRMWKDRVRLKRIKERQKAGSQGAQTKETPKKISDQAQRKKMSRAQDGILKYMLKLMEVCKVRGFVYGIIPEKGKPVSGSSDNIRAWWKEKVKFDKNGPAAIAKYEEECLAFGKSDGNR---NSQFVLQDLQDATLGSLLSSLMQHCDPPQRKYPLEKGTPPPWWPTGNEEWWVKLGLPKSQ-SPPYRKPHDLKKMWKVGVLTAVINHMLPDIAKI 253          
BLAST of CB290282 vs. ExPASy Swiss-Prot
Match: EIL2_ARATH (ETHYLENE INSENSITIVE 3-like 2 protein OS=Arabidopsis thaliana GN=EIL2 PE=1 SV=1)

HSP 1 Score: 280.411 bits (716), Expect = 7.323e-75
Identity = 139/222 (62.61%), Postives = 165/222 (74.32%), Query Frame = 3
Query:  114 LERRMWKDKMRLKRLKEQSRGKEGIDMAKQRQSQ---EQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPAAIAKYQAD-NSVPGKNEGINAIGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVSPPWWPTGKEEWWPQLGLPKD-QGA-PPYKKPHDLKKAWKVGVLTAVIKHMSPDIAKI 761
            LE+++W+DK RLKRLKE ++   G  +  ++Q     E + ++ M +AQDGILKYM K ME  KAQGFVYGI+ E GK V G+SDNLREWWKDKVRFDRNGPAAI K+Q D N   G + G      T   L ELQDTTLG+LLSAL  HC+PPQRRFPLEKGV+PPWWPTGKE+WW QL LP D +G  PPYKKPHDLKK WK+GVL  VI+HM+ DI+ I
Sbjct:   50 LEKKIWRDKQRLKRLKEMAKNGLGTRLLLKQQHDDFPEHSSKRTMYKAQDGILKYMSKTMERYKAQGFVYGIVLENGKTVAGSSDNLREWWKDKVRFDRNGPAAIIKHQRDINLSDGSDSGSEVGDSTAQKLLELQDTTLGALLSALFPHCNPPQRRFPLEKGVTPPWWPTGKEDWWDQLSLPVDFRGVPPPYKKPHDLKKLWKIGVLIGVIRHMASDISNI 271          
BLAST of CB290282 vs. ExPASy Swiss-Prot
Match: EIL4_ARATH (Putative ETHYLENE INSENSITIVE 3-like 4 protein OS=Arabidopsis thaliana GN=EIL4 PE=2 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 2.783e-74
Identity = 131/220 (59.55%), Postives = 167/220 (75.91%), Query Frame = 3
Query:  114 LERRMWKDKMRL-KRLKEQSRGKEGIDMAKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPAAIAKYQADNSVPGKNEGINAIGPTP---HTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVSPPWWPTGKEEWWPQLGLPKDQGAPPYKKPHDLKKAWKVGVLTAVIKHMSPDIAKI 761
            L+RRMWKD+  + K+LK+Q R    + ++      E +RRKKM+R+QD +LKYM+K+MEVCKA+GFVYGI+PEKGKP+TG+SD+LR WWK+ V+FD+N P AI  Y A  +     E I+    +    H LQELQDTTLGSLLSALMQHC PPQRRFPLEKG++PPWWPTG E WW + G   + GAPPY+KPHDL+K+WKV VL AVIKHMSP++ ++
Sbjct:   25 LKRRMWKDRNLMEKKLKQQKRHSNDV-VSFTTHRAEASRRKKMARSQDSVLKYMMKIMEVCKAKGFVYGIVPEKGKPITGSSDSLRRWWKENVQFDQNAPDAITDYLALAAAAAAAELIDKSSSSSSLLHMLQELQDTTLGSLLSALMQHCMPPQRRFPLEKGIAPPWWPTGTELWWGEQGAAHEHGAPPYRKPHDLRKSWKVSVLAAVIKHMSPNLGRV 243          
BLAST of CB290282 vs. ExPASy Swiss-Prot
Match: EIL5_ARATH (ETHYLENE INSENSITIVE 3-like 5 protein OS=Arabidopsis thaliana GN=EIL5 PE=2 SV=1)

HSP 1 Score: 261.151 bits (666), Expect = 4.597e-69
Identity = 128/234 (54.70%), Postives = 163/234 (69.66%), Query Frame = 3
Query:  114 LERRMWKDKMRLKRLKEQSRGKEGIDMAKQRQSQ---------------EQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPEKGKPVTGASDNLREWWKDKVRFDRNGPAAIAKY--QADNSVPGKNEGINAIGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVSPPWWPTGKEEWWPQLGLPK-DQGAPPYKKPHDLKKAWKVGVLTAVIKHMSPDIAKI 761
            L++RMWKD+  + +LK+Q R      ++    S                E +RRKKM+R+QD +LKYM+K+MEVCKAQGFVYGI+PEKGKPVTG+SD+LR WWK+ V+FD+  P A++ Y   A   +   NE ++      H L ELQDTTLGSLLSALMQHC PPQRRFPLEKG++PPWWP G E WW + G    + G PPY+KPHDL+KAWKV VL AVIKHMSP++ ++
Sbjct:   40 LKKRMWKDRNLMCKLKQQKRDNLNSVISSPSSSTSASSSSSSSVIVRRTEASRRKKMARSQDSVLKYMMKIMEVCKAQGFVYGIVPEKGKPVTGSSDSLRRWWKENVQFDQTAPNAVSDYLTLAAAQLISSNESLDP-NSYIHMLHELQDTTLGSLLSALMQHCVPPQRRFPLEKGLAPPWWPNGTELWWGEQGAAAFEHGPPPYRKPHDLRKAWKVSVLAAVIKHMSPNLERV 272          
The following BLAST results are available for this feature:
BLAST of CB290282 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
EIN3_ARATH1.841e-11881.20Protein ETHYLENE INSENSITIVE 3 OS=Arabidopsis thal... [more]
EIL1_ARATH2.574e-11288.07ETHYLENE INSENSITIVE 3-like 1 protein OS=Arabidops... [more]
EIL3_ARATH1.204e-8569.27ETHYLENE INSENSITIVE 3-like 3 protein OS=Arabidops... [more]
EIL2_ARATH7.323e-7562.61ETHYLENE INSENSITIVE 3-like 2 protein OS=Arabidops... [more]
EIL4_ARATH2.783e-7459.55Putative ETHYLENE INSENSITIVE 3-like 4 protein OS=... [more]
EIL5_ARATH4.597e-6954.70ETHYLENE INSENSITIVE 3-like 5 protein OS=Arabidops... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS01_01ae08_g1 Washington Navel orange cold acclimated flavedo & albedo cDNA library Citrus sinensis cDNA clone UCRCS01_01ae08, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB290282 ID=CB290282|Name=CB290282|organism=Citrus sinensis|type=EST|length=763bp
GTCCGTAGATCTTCTCTGCTCCTCTGGGAGATGCAGATATGCCCTTCCAA
CCATCTGAACCGGAGGCTACCGTGGAGGATGATTATACTGATGAAGAGAT
GGATGTTGATGACCTTGAGAGGAGGATGTGGAAGGACAAAATGCGTCTCA
AACGGCTGAAAGAACAAAGCAGGGGCAAGGAGGGAATTGACATGGCCAAG
CAACGTCAGTCGCAAGAGCAGGCAAGGAGGAAGAAGATGTCGAGGGCTCA
AGATGGGATCTTGAAATACATGTTAAAAATGATGGAAGTTTGTAAAGCTC
AAGGTTTTGTCTATGGGATTATTCCAGAGAAAGGAAAGCCTGTGACTGGG
GCATCTGACAATCTCCGTGAGTGGTGGAAGGATAAGGTTAGGTTTGATCG
TAATGGTCCAGCTGCTATAGCTAAGTACCAAGCTGATAATTCAGTCCCTG
GCAAGAATGAGGGCATTAACGCAATTGGTCCAACCCCGCATACCTTGCAA
GAGTTGCAAGACACCACCCTTGGTTCACTCTTGTCGGCTCTCATGCAGCA
CTGTGATCCTCCTCAGAGGCGGTTTCCCCTGGAGAAGGGTGTTTCCCCCC
CATGGTGGCCCACTGGAAAAGAGGAATGGTGGCCGCAATTGGGTTTGCCC
AAGGATCAAGGTGCTCCACCTTACAAGAAGCCACATGACTTAAAGAAGGC
ATGGAAAGTGGGTGTGTTGACGGCAGTGATCAAGCATATGTCCCCAGATA
TTGCCAAGATTCG
back to top