CB294008

Overview
NameCB294008
Unique NameCB294008
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length737
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CB294008_ssr1 microsatellite CB294008_ssr1:1..10. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig1582 contig Csv1_Contig1582:41..777. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB294008 vs. ExPASy Swiss-Prot
Match: 14337_SOLLC (14-3-3 protein 7 OS=Solanum lycopersicum GN=TFT7 PE=2 SV=2)

HSP 1 Score: 391.349 bits (1004), Expect = 2.776e-108
Identity = 198/228 (86.84%), Postives = 209/228 (91.67%), Query Frame = 2
Query:   53 MEKEREHHVYLARLAEQAERYDEMVEAMKKVAKLDVELTVEERNLVSVGYKNVIGARRASWRILSSIEQKEEAKGNEQNVKRIKEYRQRVEDELAKICNDILSVIDEHLIPSSTSGESTVFYYKMKGDYYRYLAEFKGADDRKEAADHSLKXXXXXXXXXXSELPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDSLNEESYKDSTLIMQLLRDN 736
            MEKERE  VYLARLAEQAERYDEMVEAMK +AK+DVELTVEERNLVSVGYKNVIGARRASWRILSSIEQKEE+KG+EQNVKRIK YRQRVEDEL KIC+DILSVIDEHL+PSST+GESTVFYYKMKGDYYRYLAEFK  DDRKEA++ SLK          S+L PTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDSL+EESYKDSTLIMQLLRDN
Sbjct:    1 MEKEREKQVYLARLAEQAERYDEMVEAMKAIAKMDVELTVEERNLVSVGYKNVIGARRASWRILSSIEQKEESKGHEQNVKRIKTYRQRVEDELTKICSDILSVIDEHLVPSSTTGESTVFYYKMKGDYYRYLAEFKAGDDRKEASEQSLKAYEAATATASSDLAPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDSLSEESYKDSTLIMQLLRDN 228          
BLAST of CB294008 vs. ExPASy Swiss-Prot
Match: 1433_TOBAC (14-3-3-like protein OS=Nicotiana tabacum PE=2 SV=1)

HSP 1 Score: 373.629 bits (958), Expect = 5.990e-103
Identity = 193/228 (84.65%), Postives = 204/228 (89.47%), Query Frame = 2
Query:   53 MEKEREHHVYLARLAEQAERYDEMVEAMKKVAKLDVELTVEERNLVSVGYKNVIGARRASWRILSSIEQKEEAKGNEQNVKRIKEYRQRVEDELAKICNDILSVIDEHLIPSSTSGESTVFYYKMKGDYYRYLAEFKGADDRKEAADHSLKXXXXXXXXXXSELPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDSLNEESYKDSTLIMQLLRDN 736
            M+KERE  VYLARLAEQAERYDEMVEAMK VAK+DVELTVEERNLVSVGYKNVIGARRASWRILSSIEQKEE+KG++QNVKRIK Y+QRVEDEL K     LSVIDEH++PSSTSGESTVFYYKMKGDYYRYLAEFK  DDRKEAAD SLK          ++L PTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDSL+EESYKDSTLIMQLLRDN
Sbjct:    1 MDKEREKQVYLARLAEQAERYDEMVEAMKTVAKMDVELTVEERNLVSVGYKNVIGARRASWRILSSIEQKEESKGHDQNVKRIKTYQQRVEDELTKYALT-LSVIDEHVVPSSTSGESTVFYYKMKGDYYRYLAEFKSGDDRKEAADQSLKAYEAATATASADLAPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDSLSEESYKDSTLIMQLLRDN 227          
BLAST of CB294008 vs. ExPASy Swiss-Prot
Match: 1433D_SOYBN (14-3-3-like protein D OS=Glycine max GN=GF14D PE=2 SV=1)

HSP 1 Score: 368.622 bits (945), Expect = 1.927e-101
Identity = 182/226 (80.53%), Postives = 203/226 (89.82%), Query Frame = 2
Query:   59 KEREHHVYLARLAEQAERYDEMVEAMKKVAKLDVELTVEERNLVSVGYKNVIGARRASWRILSSIEQKEEAKGNEQNVKRIKEYRQRVEDELAKICNDILSVIDEHLIPSSTSGESTVFYYKMKGDYYRYLAEFKGADDRKEAADHSLKXXXXXXXXXXSELPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDSLNEESYKDSTLIMQLLRDN 736
            K+RE+ VY+A+LAEQAERY+EMVE+MK VA LDVELTVEERNL+SVGYKNVIGARRASWRILSSIEQKEE KGNE N KRIKEYRQ+VE EL+ ICND++ VIDEHLIPS+ +GESTVFYYKMKGDYYRYLAEFK  +++KEAAD S+K          ++LPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAI+ELD+LNEESYKDSTLIMQLLRDN
Sbjct:    5 KDRENFVYIAKLAEQAERYEEMVESMKNVANLDVELTVEERNLLSVGYKNVIGARRASWRILSSIEQKEETKGNELNAKRIKEYRQKVELELSNICNDVMRVIDEHLIPSAAAGESTVFYYKMKGDYYRYLAEFKSGNEKKEAADQSMKAYESATAAAEADLPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAISELDTLNEESYKDSTLIMQLLRDN 230          
BLAST of CB294008 vs. ExPASy Swiss-Prot
Match: 14310_ARATH (14-3-3-like protein GF14 epsilon OS=Arabidopsis thaliana GN=GRF10 PE=2 SV=1)

HSP 1 Score: 367.081 bits (941), Expect = 5.606e-101
Identity = 185/228 (81.14%), Postives = 202/228 (88.60%), Query Frame = 2
Query:   53 MEKEREHHVYLARLAEQAERYDEMVEAMKKVAKLDVELTVEERNLVSVGYKNVIGARRASWRILSSIEQKEEAKGNEQNVKRIKEYRQRVEDELAKICNDILSVIDEHLIPSSTSGESTVFYYKMKGDYYRYLAEFKGADDRKEAADHSLKXXXXXXXXXXSELPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDSLNEESYKDSTLIMQLLRDN 736
            ME ERE  VYLA+L+EQ ERYDEMVEAMKKVA+LDVELTVEERNLVSVGYKNVIGARRASWRILSSIEQKEE+KGN++NVKR+K YR+RVEDELAK+CNDILSVID+HLIPSS + ESTVF+YKMKGDYYRYLAEF    +RKEAAD SL+          + L PTHP+RLGLALNFSVFYYEILNSPE AC LAKQAFD+AIAELDSLNEESYKDSTLIMQLLRDN
Sbjct:    1 MENEREKQVYLAKLSEQTERYDEMVEAMKKVAQLDVELTVEERNLVSVGYKNVIGARRASWRILSSIEQKEESKGNDENVKRLKNYRKRVEDELAKVCNDILSVIDKHLIPSSNAVESTVFFYKMKGDYYRYLAEFSSGAERKEAADQSLEAYKAAVAAAENGLAPTHPVRLGLALNFSVFYYEILNSPESACQLAKQAFDDAIAELDSLNEESYKDSTLIMQLLRDN 228          
BLAST of CB294008 vs. ExPASy Swiss-Prot
Match: 14311_ARATH (14-3-3-like protein GF14 omicron OS=Arabidopsis thaliana GN=GRF11 PE=2 SV=1)

HSP 1 Score: 365.54 bits (937), Expect = 1.631e-100
Identity = 185/228 (81.14%), Postives = 202/228 (88.60%), Query Frame = 2
Query:   53 MEKEREHHVYLARLAEQAERYDEMVEAMKKVAKLDVELTVEERNLVSVGYKNVIGARRASWRILSSIEQKEEAKGNEQNVKRIKEYRQRVEDELAKICNDILSVIDEHLIPSSTSGESTVFYYKMKGDYYRYLAEFKGADDRKEAADHSLKXXXXXXXXXXSELPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDSLNEESYKDSTLIMQLLRDN 736
            ME ER   VYLA+L EQAERYDEMVEAMKKVA LDVELT+EERNL+SVGYKNVIGARRASWRILSSIEQKEE+KGNEQN KRIK+YR +VE+EL+KIC DIL+VID+HL+P +TSGESTVFYYKMKGDY+RYLAEFK   DR+EAAD SLK          +EL  THPIRLGLALNFSVFYYEILNSPERACHLAK+AFDEAIAELDSLNE+SYKDSTLIMQLLRDN
Sbjct:    1 MENERAKQVYLAKLNEQAERYDEMVEAMKKVAALDVELTIEERNLLSVGYKNVIGARRASWRILSSIEQKEESKGNEQNAKRIKDYRTKVEEELSKICYDILAVIDKHLVPFATSGESTVFYYKMKGDYFRYLAEFKSGADREEAADLSLKAYEAATSSASTELSTTHPIRLGLALNFSVFYYEILNSPERACHLAKRAFDEAIAELDSLNEDSYKDSTLIMQLLRDN 228          
BLAST of CB294008 vs. ExPASy Swiss-Prot
Match: 14339_SOLLC (14-3-3 protein 9 OS=Solanum lycopersicum GN=TFT9 PE=2 SV=2)

HSP 1 Score: 363.614 bits (932), Expect = 6.199e-100
Identity = 180/226 (79.65%), Postives = 202/226 (89.38%), Query Frame = 2
Query:   59 KEREHHVYLARLAEQAERYDEMVEAMKKVAKLDVELTVEERNLVSVGYKNVIGARRASWRILSSIEQKEEAKGNEQNVKRIKEYRQRVEDELAKICNDILSVIDEHLIPSSTSGESTVFYYKMKGDYYRYLAEFKGADDRKEAADHSLKXXXXXXXXXXSELPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDSLNEESYKDSTLIMQLLRDN 736
            KERE+ VY+A+LAEQAERYDEMVEAMK VA +DVELTVEERNL+SVGYKNV+G+RRASWRILSSIEQKEE++GNEQNVKRIKEY Q+VE EL  ICNDI+ VID+HLIPS ++GESTVFY+KMKGDYYRYLAEFK  +D+KE A+ SLK          +EL PTHPIRLGLALNFSVFYYEI+NSPERACHLAKQAFDEAI+ELDSLNE+SYKDSTLIMQLLRDN
Sbjct:    5 KERENFVYVAKLAEQAERYDEMVEAMKNVANMDVELTVEERNLLSVGYKNVVGSRRASWRILSSIEQKEESRGNEQNVKRIKEYLQKVESELTNICNDIMVVIDQHLIPSCSAGESTVFYHKMKGDYYRYLAEFKAGNDKKEVAELSLKAYQAATTAAEAELAPTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEAISELDSLNEDSYKDSTLIMQLLRDN 230          
BLAST of CB294008 vs. ExPASy Swiss-Prot
Match: 14312_ARATH (14-3-3-like protein GF14 iota OS=Arabidopsis thaliana GN=GRF12 PE=2 SV=1)

HSP 1 Score: 362.844 bits (930), Expect = 1.057e-99
Identity = 180/227 (79.30%), Postives = 203/227 (89.43%), Query Frame = 2
Query:   56 EKEREHHVYLARLAEQAERYDEMVEAMKKVAKLDVELTVEERNLVSVGYKNVIGARRASWRILSSIEQKEEAKGNEQNVKRIKEYRQRVEDELAKICNDILSVIDEHLIPSSTSGESTVFYYKMKGDYYRYLAEFKGADDRKEAADHSLKXXXXXXXXXXSELPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDSLNEESYKDSTLIMQLLRDN 736
            +KERE  VY+A+L+EQAERYDEMVE MKKVA+++ ELTVEERNL+SVGYKNVIGARRASWRI+SSIEQKEE+KGNE NVK+IK YRQ+VEDELA IC DIL++ID+HLIP +TSGE+TVFYYKMKGDYYRYLAEFK   +RKEAA+ SLK          +ELP THPIRLGLALNFSVFYYEI+NSPERACHLAKQAFDEAIAELD+L+EESYKDSTLIMQLLRDN
Sbjct:    7 DKERETFVYMAKLSEQAERYDEMVETMKKVARVNSELTVEERNLLSVGYKNVIGARRASWRIMSSIEQKEESKGNESNVKQIKGYRQKVEDELANICQDILTIIDQHLIPHATSGEATVFYYKMKGDYYRYLAEFKTEQERKEAAEQSLKGYEAATQAASTELPSTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEAIAELDTLSEESYKDSTLIMQLLRDN 233          
BLAST of CB294008 vs. ExPASy Swiss-Prot
Match: 1433C_SOYBN (14-3-3-like protein C OS=Glycine max GN=GF14C PE=2 SV=1)

HSP 1 Score: 360.918 bits (925), Expect = 4.018e-99
Identity = 180/226 (79.65%), Postives = 204/226 (90.27%), Query Frame = 2
Query:   59 KEREHHVYLARLAEQAERYDEMVEAMKKVAKLDVELTVEERNLVSVGYKNVIGARRASWRILSSIEQKEEAKGNEQNVKRIKEYRQRVEDELAKICNDILSVIDEHLIPSSTSGESTVFYYKMKGDYYRYLAEFKGADDRKEAADHSLKXXXXXXXXXXSELPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDSLNEESYKDSTLIMQLLRDN 736
            KERE+ VY+A+LAEQAERY+EMVEAMK VA L+VELTVEERNL+SVGYKNV+GARRASWRILSSIEQKEEAKGN+ +VKRIKEYR +VE EL+ IC+DI++VIDE+LIPSS+SGE +VF+YKMKGDYYRYLAEFK  D+RKEAADHS+K          +EL  THPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAI+ELD+L+EESYKDSTLIMQLLRDN
Sbjct:    5 KERENFVYVAKLAEQAERYEEMVEAMKNVANLNVELTVEERNLLSVGYKNVVGARRASWRILSSIEQKEEAKGNDVSVKRIKEYRLKVESELSNICSDIMTVIDEYLIPSSSSGEPSVFFYKMKGDYYRYLAEFKSGDERKEAADHSMKAYQLASTTAEAELASTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAISELDTLSEESYKDSTLIMQLLRDN 230          
BLAST of CB294008 vs. ExPASy Swiss-Prot
Match: 1433B_VICFA (14-3-3-like protein B OS=Vicia faba PE=2 SV=1)

HSP 1 Score: 360.918 bits (925), Expect = 4.018e-99
Identity = 177/226 (78.32%), Postives = 201/226 (88.94%), Query Frame = 2
Query:   59 KEREHHVYLARLAEQAERYDEMVEAMKKVAKLDVELTVEERNLVSVGYKNVIGARRASWRILSSIEQKEEAKGNEQNVKRIKEYRQRVEDELAKICNDILSVIDEHLIPSSTSGESTVFYYKMKGDYYRYLAEFKGADDRKEAADHSLKXXXXXXXXXXSELPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDSLNEESYKDSTLIMQLLRDN 736
            K+RE+ VY+A+LAEQAERY+EMV++MK VA LDVELT+EERNL+SVGYKNVIGARRASWRILSSIEQKEE+KGN+ N KRIKEYR +VE EL+ IC D++ VIDEHLIPS+ +GESTVFYYKMKGDYYRYLAEFK  +++KEA D S+K          +ELPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAI+ELD+LNEESYKDSTLIMQLLRDN
Sbjct:    5 KDRENFVYIAKLAEQAERYEEMVDSMKNVANLDVELTIEERNLLSVGYKNVIGARRASWRILSSIEQKEESKGNDVNAKRIKEYRHKVETELSNICIDVMRVIDEHLIPSAAAGESTVFYYKMKGDYYRYLAEFKTGNEKKEAGDQSMKAYESATTAAEAELPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAISELDTLNEESYKDSTLIMQLLRDN 230          
BLAST of CB294008 vs. ExPASy Swiss-Prot
Match: 14338_SOLLC (14-3-3 protein 8 OS=Solanum lycopersicum GN=TFT8 PE=2 SV=2)

HSP 1 Score: 357.451 bits (916), Expect = 4.442e-98
Identity = 178/226 (78.76%), Postives = 199/226 (88.05%), Query Frame = 2
Query:   59 KEREHHVYLARLAEQAERYDEMVEAMKKVAKLDVELTVEERNLVSVGYKNVIGARRASWRILSSIEQKEEAKGNEQNVKRIKEYRQRVEDELAKICNDILSVIDEHLIPSSTSGESTVFYYKMKGDYYRYLAEFKGADDRKEAADHSLKXXXXXXXXXXSELPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDSLNEESYKDSTLIMQLLRDN 736
            KERE  VY+ARLAEQAERYDEMV+AMK VA LDVELTVEERNL+SVGYKNV+G+RRASWRILSSIEQKE+A+GNEQNVKRI+ YRQ+VE EL  ICN+I++VIDEHLIPS T+GESTVFYYKMKGDYYRYLAEFK  DD+KE +D SLK          +ELP THPIRLGLALNFSVFYYEI+NSPERAC LAKQ FDEAI+ELDSLNE++YKD TLI+QLLRDN
Sbjct:    5 KERESLVYIARLAEQAERYDEMVDAMKNVANLDVELTVEERNLLSVGYKNVVGSRRASWRILSSIEQKEDARGNEQNVKRIQGYRQKVESELTDICNNIMTVIDEHLIPSCTAGESTVFYYKMKGDYYRYLAEFKTGDDKKEVSDLSLKAYQTATTTAEAELPITHPIRLGLALNFSVFYYEIMNSPERACQLAKQVFDEAISELDSLNEDNYKDGTLILQLLRDN 230          
The following BLAST results are available for this feature:
BLAST of CB294008 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 143
Match NameE-valueIdentityDescription
14337_SOLLC2.776e-10886.8414-3-3 protein 7 OS=Solanum lycopersicum GN=TFT7 P... [more]
1433_TOBAC5.990e-10384.6514-3-3-like protein OS=Nicotiana tabacum PE=2 SV=1[more]
1433D_SOYBN1.927e-10180.5314-3-3-like protein D OS=Glycine max GN=GF14D PE=2... [more]
14310_ARATH5.606e-10181.1414-3-3-like protein GF14 epsilon OS=Arabidopsis th... [more]
14311_ARATH1.631e-10081.1414-3-3-like protein GF14 omicron OS=Arabidopsis th... [more]
14339_SOLLC6.199e-10079.6514-3-3 protein 9 OS=Solanum lycopersicum GN=TFT9 P... [more]
14312_ARATH1.057e-9979.3014-3-3-like protein GF14 iota OS=Arabidopsis thali... [more]
1433C_SOYBN4.018e-9979.6514-3-3-like protein C OS=Glycine max GN=GF14C PE=2... [more]
1433B_VICFA4.018e-9978.3214-3-3-like protein B OS=Vicia faba PE=2 SV=1[more]
14338_SOLLC4.442e-9878.7614-3-3 protein 8 OS=Solanum lycopersicum GN=TFT8 P... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS01_06ba07_g1 Washington Navel orange cold acclimated flavedo & albedo cDNA library Citrus sinensis cDNA clone UCRCS01_06ba07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB294008 ID=CB294008|Name=CB294008|organism=Citrus sinensis|type=EST|length=737bp
GAGAGAGAGAAGGAAGAGAGCTAGCGAGAGAAAGAGTGAGTGACTGAACG
AAATGGAGAAGGAGAGAGAGCATCATGTTTACTTGGCCAGACTTGCTGAG
CAAGCCGAGAGATACGACGAGATGGTTGAAGCCATGAAGAAAGTTGCCAA
GTTGGATGTGGAACTGACTGTGGAGGAGAGGAATCTGGTGTCTGTTGGGT
ACAAGAATGTGATTGGGGCAAGAAGAGCATCATGGAGGATTTTGTCTTCC
ATTGAACAGAAGGAGGAGGCCAAGGGTAATGAACAAAATGTGAAGAGGAT
TAAGGAATATAGGCAGAGGGTTGAAGATGAGCTTGCAAAGATCTGTAATG
ATATATTGTCTGTCATTGATGAACACCTAATCCCATCCTCCACATCTGGA
GAATCAACCGTGTTTTACTATAAGATGAAAGGAGATTATTACCGTTACCT
AGCTGAGTTCAAAGGTGCTGATGATCGTAAGGAAGCTGCAGATCATTCAC
TTAAGGCTTACGAGGCTGCTACAGCTGCAGCAGCCTCAGAGTTACCCCCA
ACTCATCCAATCAGACTTGGCCTGGCTCTTAACTTTTCTGTTTTCTACTA
TGAGATTTTGAACTCACCTGAGAGGGCTTGCCACCTGGCTAAACAAGCAT
TTGATGAGGCGATTGCTGAACTTGATAGCCTTAATGAAGAGTCCTACAAG
GACAGCACCCTTATTATGCAGCTTCTTCGGGATAATC
back to top