CB294013

Overview
NameCB294013
Unique NameCB294013
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length728
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CB294013_ssr9 microsatellite CB294013_ssr9:9..46. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig12558 contig Csv1_Contig12558:719..1446. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB294013 vs. ExPASy Swiss-Prot
Match: MCA5_ARATH (Metacaspase-5 OS=Arabidopsis thaliana GN=AMC5 PE=1 SV=1)

HSP 1 Score: 246.128 bits (627), Expect = 1.409e-64
Identity = 124/197 (62.94%), Postives = 152/197 (77.16%), Query Frame = -1
Query:  114 NKSLPLSTLIEILKQQTGKDDIDVGKIRPTLFDMFGEDATPKVKKFMKVLLTKLKQXXXXXXXXXXXXXXGSLAQEFLKHKLEESDESYAKPALETEVGSKKDVYAGGSKRSLPHGGILVSGCQTDQTSADASPSGKASEAYGAVSNAIQIIIAESDGAVTNRELVLSTRQMLKKQGFTQQPGLYCQDNHVDKPFIC 704
            NKSLPL TLI+ILKQ TG +DI+VGKIRPTLF++FGEDA+PKVKKFMKV+LTKL++                LAQEFLKHKL + DE Y KPA++T VG+K++VYAG S  SL   GIL+SGCQTDQTSADASP G    AYGA +NA+QII+ E+ G +T +ELVL  R++LKKQGF+Q+PGLYC D+ V+ PFIC
Sbjct:  218 NKSLPLQTLIDILKQNTGNNDIEVGKIRPTLFNVFGEDASPKVKKFMKVILTKLQEGKTEGGILGMIG---KLAQEFLKHKLND-DEEYVKPAMKTHVGNKQEVYAGASNGSLADNGILISGCQTDQTSADASPQGHPEMAYGAFTNAVQIILEETKGMITYKELVLKARKLLKKQGFSQRPGLYCSDSFVNAPFIC 410          
BLAST of CB294013 vs. ExPASy Swiss-Prot
Match: MCA4_ARATH (Metacaspase-4 OS=Arabidopsis thaliana GN=AMC4 PE=1 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 1.558e-63
Identity = 125/206 (60.68%), Postives = 157/206 (76.21%), Query Frame = -1
Query:  114 GEGGYHKNKSLPLSTLIEILKQQTGKDDIDVGKIRPTLFDMFGEDATPKVKKFMKVLLTKLKQXXXXXXXXXXXXXXGSLAQEFLKHKLEESDESYAKPALETEVGSKKDVYAGGSKRS--LPHGGILVSGCQTDQTSADASPSGKASEAYGAVSNAIQIIIAESDGAVTNRELVLSTRQMLKKQGFTQQPGLYCQDNHVDKPFIC 725
            GE  + K+KSLPL TLI+ILKQQTG D+I+VGKIRP+LFD FG+D++PKVKKFMKV+L KL+                 LA  FL+ KL  +DE Y KPA++T VGSK++VYAGGS+ S  LP  GIL+SGCQTDQTSADA+P+GK +EAYGA+SN+IQ I+ E+DG ++NRE+V   R+ LKKQGFTQQPGLYC D + + PFIC
Sbjct:  217 GETIHAKDKSLPLQTLIDILKQQTGNDNIEVGKIRPSLFDAFGDDSSPKVKKFMKVILGKLQAGNGEEGGLMGMLG--KLASGFLEGKL--NDEDYVKPAMQTHVGSKEEVYAGGSRGSVPLPDSGILISGCQTDQTSADATPAGKPTEAYGAMSNSIQTILEETDGEISNREMVTRARKALKKQGFTQQPGLYCHDGYANAPFIC 418          
BLAST of CB294013 vs. ExPASy Swiss-Prot
Match: MCA6_ARATH (Metacaspase-6 OS=Arabidopsis thaliana GN=AMC6 PE=1 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 5.555e-53
Identity = 108/199 (54.27%), Postives = 141/199 (70.85%), Query Frame = -1
Query:  114 NKSLPLSTLIEILKQQTGKDDIDVGKIRPTLFDMFGEDATPKVKKFMKVLLTKLKQXXXXXXXXXXXXXXG--SLAQEFLKHKLEESDESYAKPALETEVGSKKDVYAGGSKRSLPHGGILVSGCQTDQTSADASPSGKASEAYGAVSNAIQIIIAESDGAVTNRELVLSTRQMLKKQGFTQQPGLYCQDNHVDKPFIC 704
            N+SLPL TLI++LKQ+TG DDI+VGKIR TLFDMFG+D++PKVKKFM V+L+ L++                 +LAQEFL+ KL +      KPA++       DVYAG    +LP  GIL+SGCQTDQTS+DASP G    AYGA++NAIQIII E+ G ++N++LVL  R++L+KQGF Q+PGLYC D +V+  FIC
Sbjct:  181 NRSLPLETLIDMLKQETGNDDIEVGKIRTTLFDMFGDDSSPKVKKFMNVILSNLQETTTTIQTVSDEVLGSVENLAQEFLEQKLSDD----VKPAIQ-------DVYAGAINGALPDNGILISGCQTDQTSSDASPPGHPELAYGALTNAIQIIIGETKGKISNKDLVLKARKLLRKQGFDQRPGLYCNDAYVNARFIC 368          
BLAST of CB294013 vs. ExPASy Swiss-Prot
Match: MCA7_ARATH (Metacaspase-7 OS=Arabidopsis thaliana GN=AMC7 PE=1 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 2.853e-49
Identity = 105/211 (49.76%), Postives = 142/211 (67.30%), Query Frame = -1
Query:  114 KNKSLPLSTLIEILKQQTGKDDIDVGKIRPTLFDMFGEDATPKVKKFMKVLLTKLKQXXXXXXXXXXXXXXGSLAQEFLKHKLEES----------DESYAKPALETEVGSKKDVYAGGSKRSL-PHGGILVSGCQTDQTSADASPSGKASEAYGAVSNAIQIIIAESD--GAVTNRELVLSTRQMLKKQGFTQQPGLYCQDNHVDKPFIC 707
            +++ LPL   IE+LKQQTG+D+I++GKIRPTLFD+FGED++PK+KKFMKV+LTKL++                  Q  L  K+EES          DE Y KPA++ +V S +++Y G S   L P  GIL+SGCQTD+TSAD    G   EA+GA SNAIQ++++E+D    +TN+E+VL  R++LKKQ F Q+PGLYC D  V+ PFIC
Sbjct:  211 RSRYLPLERFIELLKQQTGQDNIEIGKIRPTLFDVFGEDSSPKIKKFMKVILTKLRKTND---------------QSTLLGKIEESARGYIEETLNDEHYMKPAMQAQVKSDREIYGGRSSNGLFPDRGILLSGCQTDETSADVKKKG---EAFGAFSNAIQMVLSETDHKDKITNKEMVLRAREILKKQMFIQRPGLYCNDRFVNAPFIC 403          
BLAST of CB294013 vs. ExPASy Swiss-Prot
Match: MCA8_ARATH (Metacaspase-8 OS=Arabidopsis thaliana GN=AMC8 PE=1 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 5.071e-22
Identity = 68/202 (33.66%), Postives = 102/202 (50.50%), Query Frame = -1
Query:  114 KNKSLPLSTLIEILKQQTGKDDIDVGKIRPTLFDMFGEDATPKVKKFMKVLLTKLKQXXXXXXXXXXXXXXGSLAQEFLKHKLEESDESYAKPALETEVGSKKDVYAGGSK-RSLPHGGILVSGCQTDQTSADASPSGKASEAYGAVSNAIQIIIA---ESDGAVTNRELVLSTRQMLKKQGFTQQPGLYCQDNHVDKPFIC 707
            K + LP  + + +LK+QTG+ +I+  +IR TL  +FGED +P  ++ +  L                                            E + G      +G S+  ++   GIL+SGCQTDQ S D   + +  +AYGA S+AIQ+I++   +    +TN+ELV   R  LKK+G++Q+PGLYC D  VDKPFIC
Sbjct:  226 KTRYLPFESYLSLLKEQTGQTNIEPVRIRQTLLKLFGEDPSPNRQRGLSDLGN-----------------------------------------CEVDAGD-----SGASRLNAVTDNGILLSGCQTDQRSEDVYVT-RTGKAYGAFSDAIQMILSAPRKDKKKITNKELVSEARVFLKKRGYSQRPGLYCHDRFVDKPFIC 380          
BLAST of CB294013 vs. ExPASy Swiss-Prot
Match: MCA9_ARATH (Metacaspase-9 OS=Arabidopsis thaliana GN=AMC9 PE=1 SV=1)

HSP 1 Score: 82.0333 bits (201), Expect = 3.520e-15
Identity = 39/80 (48.75%), Postives = 55/80 (68.75%), Query Frame = -1
Query:  117 GILVSGCQTDQTSADASPSGKASEAYGAVSNAIQIIIAESDGAVTNRELVLSTRQMLKKQGFTQQPGLYCQDNHVDKPFI 356
            GIL+SGCQ D+TSAD        +AYGA SNAIQ ++ E++GA+ N++LV+  R +L++ GF Q P LYC D + D  F+
Sbjct:  245 GILMSGCQADETSADVGVGN--GKAYGAFSNAIQRVLNENEGAMKNKQLVMMARDVLERLGFHQHPCLYCSDQNADATFL 322          
The following BLAST results are available for this feature:
BLAST of CB294013 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
MCA5_ARATH1.409e-6462.94Metacaspase-5 OS=Arabidopsis thaliana GN=AMC5 PE=1... [more]
MCA4_ARATH1.558e-6360.68Metacaspase-4 OS=Arabidopsis thaliana GN=AMC4 PE=1... [more]
MCA6_ARATH5.555e-5354.27Metacaspase-6 OS=Arabidopsis thaliana GN=AMC6 PE=1... [more]
MCA7_ARATH2.853e-4949.76Metacaspase-7 OS=Arabidopsis thaliana GN=AMC7 PE=1... [more]
MCA8_ARATH5.071e-2233.66Metacaspase-8 OS=Arabidopsis thaliana GN=AMC8 PE=1... [more]
MCA9_ARATH3.520e-1548.75Metacaspase-9 OS=Arabidopsis thaliana GN=AMC9 PE=1... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS01_06cc06_g1 Washington Navel orange cold acclimated flavedo & albedo cDNA library Citrus sinensis cDNA clone UCRCS01_06cc06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB294013 ID=CB294013|Name=CB294013|organism=Citrus sinensis|type=EST|length=728bp
GCACGTGGCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTACAA
CAAACCCTGCAAACTGTTTAAATTATTCGATCTCCTGAACCCCAAAAGCA
CCCGCTCGTATCAGCAGATAAACGGCTTATCAACATGATTATCCTGGCAA
TAAAGGCCAGGTTGCTGAGTGAATCCCTGCTTCTTCAACATCTGCCTAGT
GGACAAAACAAGCTCCCGGTTAGTCACTGCACCATCTGATTCAGCAATAA
TGATCTGAATTGCATTGCTGACAGCTCCGTAAGCTTCGCTAGCCTTCCCA
GAAGGGCTGGCATCAGCAGAAGTTTGGTCAGTCTGACATCCACTGACCAA
AATCCCACCGTGAGGAAGTGAGCGCTTGCTTCCTCCAGCATAAACATCCT
TCTTGCTGCCCACTTCAGTCTCCAAGGCAGGTTTTGCATAACTCTCATCA
CTCTCTTCCAGCTTATGCTTTAGAAATTCTTGAGCGAGACTACCTACCAT
GCCCAAAAACCCACCACCCCCACTTTCACCATCCCCTTGCTTAAGTTTGG
TAAGAAGGACCTTCATGAACTTCTTCACTTTTGGGGTCGCATCTTCCCCA
AACATATCAAAAAGGGTTGGCCTTATCTTCCCGACGTCAATGTCATCTTT
ACCAGTTTGCTGCTTGAGTATTTCAATAAGTGTTGAGAGGGGTAAGGACT
TGTTCTTATGATAACCTCCCTCACCATA
back to top