CB304513

Overview
NameCB304513
Unique NameCB304513
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length598
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig13846 contig Csv1_Contig13846:8..604. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304513 vs. ExPASy Swiss-Prot
Match: HSP71_ARATH (Heat shock cognate 70 kDa protein 1 OS=Arabidopsis thaliana GN=HSC70-1 PE=1 SV=3)

HSP 1 Score: 227.639 bits (579), Expect = 3.611e-59
Identity = 118/150 (78.67%), Postives = 128/150 (85.33%), Query Frame = -2
Query:  160 KNKITITNDKGRLSKEEIEKMVQEAEKYKAEDDEHKKKVEAKNALENYAYNMRNTIKDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKELEGICNPIIAKMYQGGGADAG----ASMDEDXXXXXXXXXXXPKIEEVD 597
            KNKITITNDKGRLSK+EIEKMVQEAEKYK+ED+EHKKKVEAKNALENYAYNMRNTI+DEKI  KLP ADKKKIED+IE+AIQWL+GNQLAEADEFEDKMKELE ICNPIIAKMYQG G +AG    + MD+D           PKIEEVD
Sbjct:  504 KNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIQDEKIGEKLPAADKKKIEDSIEQAIQWLEGNQLAEADEFEDKMKELESICNPIIAKMYQGAGGEAGGPGASGMDDD--APPASGGAGPKIEEVD 651          
BLAST of CB304513 vs. ExPASy Swiss-Prot
Match: HSP72_ARATH (Heat shock cognate 70 kDa protein 2 OS=Arabidopsis thaliana GN=HSC70-2 PE=2 SV=2)

HSP 1 Score: 227.254 bits (578), Expect = 4.716e-59
Identity = 119/151 (78.81%), Postives = 128/151 (84.77%), Query Frame = -2
Query:  160 KNKITITNDKGRLSKEEIEKMVQEAEKYKAEDDEHKKKVEAKNALENYAYNMRNTIKDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKELEGICNPIIAKMYQGG-GADAG----ASMDEDXXXXXXXXXXXPKIEEVD 597
            KNKITITNDKGRLSKE+IEKMVQEAEKYK+ED+EHKKKVEAKNALENYAYNMRNTI+DEKI  KLP ADKKK+ED+IEEAIQWLDGNQL EADEFEDKMKELE +CNPIIAKMYQGG G +AG    + MDED           PKIEEVD
Sbjct:  504 KNKITITNDKGRLSKEDIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIRDEKIGEKLPAADKKKVEDSIEEAIQWLDGNQLGEADEFEDKMKELESVCNPIIAKMYQGGAGGEAGGPGASGMDED-EAPPASGGAGPKIEEVD 653          
BLAST of CB304513 vs. ExPASy Swiss-Prot
Match: HSP71_SOLLC (Heat shock cognate 70 kDa protein 1 OS=Solanum lycopersicum GN=HSC-I PE=2 SV=1)

HSP 1 Score: 224.172 bits (570), Expect = 3.993e-58
Identity = 114/146 (78.08%), Postives = 124/146 (84.93%), Query Frame = -2
Query:  160 KNKITITNDKGRLSKEEIEKMVQEAEKYKAEDDEHKKKVEAKNALENYAYNMRNTIKDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKELEGICNPIIAKMYQGGGADAGASMDEDXXXXXXXXXXXPKIEEVD 597
            KNKITITNDKGRLSKEEIEKMVQEAEKYKAED+E KKKVEAKN+LENYAYNMRNT+KDEKI +KL + DKKKIEDA+++AI WL+ NQLAE DEFEDKMKELEGICNPIIAKMYQG G DAG  MD+D           PKIEEVD
Sbjct:  506 KNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEELKKKVEAKNSLENYAYNMRNTVKDEKIGSKLSSDDKKKIEDAVDQAISWLESNQLAEVDEFEDKMKELEGICNPIIAKMYQGAGGDAGVPMDDD-APPSGGSSAGPKIEEVD 650          
BLAST of CB304513 vs. ExPASy Swiss-Prot
Match: HSP72_SOLLC (Heat shock cognate 70 kDa protein 2 OS=Solanum lycopersicum GN=HSC-2 PE=2 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 9.834e-57
Identity = 113/146 (77.40%), Postives = 122/146 (83.56%), Query Frame = -2
Query:  160 KNKITITNDKGRLSKEEIEKMVQEAEKYKAEDDEHKKKVEAKNALENYAYNMRNTIKDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKELEGICNPIIAKMYQGGGADAGASMDEDXXXXXXXXXXXPKIEEVD 597
            KNKITITNDKGRLSKEEIEKMVQEAEKYK+ED+EHKKKVEAKNALENYAYNMRNTIKDEKI++KL   D+ KIEDAIE+AIQWLDGNQLAEA+EFEDKMKELE +CNPIIAKMYQG G D      +D           PKIEEVD
Sbjct:  504 KNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVEAKNALENYAYNMRNTIKDEKIASKLSADDRTKIEDAIEQAIQWLDGNQLAEAEEFEDKMKELESLCNPIIAKMYQGAGGDM-----DDEGPAPSGGGAGPKIEEVD 644          
BLAST of CB304513 vs. ExPASy Swiss-Prot
Match: HSP70_MAIZE (Heat shock 70 kDa protein OS=Zea mays GN=HSP70 PE=3 SV=2)

HSP 1 Score: 219.164 bits (557), Expect = 1.284e-56
Identity = 112/146 (76.71%), Postives = 121/146 (82.88%), Query Frame = -2
Query:  160 KNKITITNDKGRLSKEEIEKMVQEAEKYKAEDDEHKKKVEAKNALENYAYNMRNTIKDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKELEGICNPIIAKMYQGGGADAGASMDEDXXXXXXXXXXXPKIEEVD 597
            KNKITITNDKGRLSKEEIEKMVQEAEKYKAED+E KKKV+AKNALENYAYNMRNTIKD+KI++KLP  DKKKIEDA++ AI WLD NQLAE +EFEDKMKELEGICNPIIAKMY G GA  GA+   D           PKIEEVD
Sbjct:  500 KNKITITNDKGRLSKEEIEKMVQEAEKYKAEDEEVKKKVDAKNALENYAYNMRNTIKDDKIASKLPAEDKKKIEDAVDGAISWLDSNQLAEVEEFEDKMKELEGICNPIIAKMYXGEGAGMGAAAGMDEDAPSGGSGAGPKIEEVD 645          
BLAST of CB304513 vs. ExPASy Swiss-Prot
Match: HSP7E_SPIOL (Chloroplast envelope membrane 70 kDa heat shock-related protein OS=Spinacia oleracea GN=SCE70 PE=1 SV=3)

HSP 1 Score: 218.779 bits (556), Expect = 1.677e-56
Identity = 105/128 (82.03%), Postives = 116/128 (90.62%), Query Frame = -2
Query:  214 KNKITITNDKGRLSKEEIEKMVQEAEKYKAEDDEHKKKVEAKNALENYAYNMRNTIKDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKELEGICNPIIAKMYQGGGADAGASMDED 597
            KNKI ITNDKGRLSKEEIEKMVQEAEKYK+ED+EHKKKVE+KNALENYAYNMRN +KDEKI AKL  ADKKKIE+AI+ +IQWLDGNQLAEADEF+DKMKELE ICNPIIAKMYQG G D G  M+++
Sbjct:  504 KNKIRITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKKKVESKNALENYAYNMRNIVKDEKIGAKLSEADKKKIEEAIDASIQWLDGNQLAEADEFDDKMKELESICNPIIAKMYQGAGGDMGGGMEDE 631          
BLAST of CB304513 vs. ExPASy Swiss-Prot
Match: HSP7C_PETHY (Heat shock cognate 70 kDa protein OS=Petunia hybrida GN=HSP70 PE=2 SV=1)

HSP 1 Score: 217.624 bits (553), Expect = 3.737e-56
Identity = 115/150 (76.67%), Postives = 126/150 (84.00%), Query Frame = -2
Query:  160 KNKITITNDKGRLSKEEIEKMVQEAEKYKAEDDEHKKKVEAKNALENYAYNMRNTIKDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKELEGICNPIIAKMYQGGGADAGASMDED----XXXXXXXXXXXPKIEEVD 597
            KNKITITNDKGRLSKEEIE+MVQEAEKYK+ED+E KKKVEAKNALENYAYNMRNTIKD+KI+++L  ADKK+IEDAI+EAI+WLD NQLAEADEFEDKMKELE ICNPIIAKMYQGG    GA+MDED               PKIEEVD
Sbjct:  504 KNKITITNDKGRLSKEEIERMVQEAEKYKSEDEELKKKVEAKNALENYAYNMRNTIKDDKINSQLSAADKKRIEDAIDEAIKWLDNNQLAEADEFEDKMKELESICNPIIAKMYQGGA--GGATMDEDGPSVGGSAGSQTGAGPKIEEVD 651          
BLAST of CB304513 vs. ExPASy Swiss-Prot
Match: HSP73_ARATH (Heat shock cognate 70 kDa protein 3 OS=Arabidopsis thaliana GN=HSC70-3 PE=1 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 2.422e-55
Identity = 113/148 (76.35%), Postives = 121/148 (81.76%), Query Frame = -2
Query:  160 KNKITITNDKGRLSKEEIEKMVQEAEKYKAEDDEHKKKVEAKNALENYAYNMRNTIKDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKELEGICNPIIAKMYQGG--GADAGASMDEDXXXXXXXXXXXPKIEEVD 597
            KNKITITNDKGRLSK+EIEKMVQEAEKYK+ED+EHKKKV+AKNALENYAYNMRNTI+DEKI  KL   DKKKIED+IE AI+WL+ NQLAE DEFEDKMKELE ICNPIIAKMYQGG  G  A   MDED           PKIEEVD
Sbjct:  504 KNKITITNDKGRLSKDEIEKMVQEAEKYKSEDEEHKKKVDAKNALENYAYNMRNTIRDEKIGEKLAGDDKKKIEDSIEAAIEWLEANQLAECDEFEDKMKELESICNPIIAKMYQGGEAGGPAAGGMDED--VPPSAGGAGPKIEEVD 649          
BLAST of CB304513 vs. ExPASy Swiss-Prot
Match: HSP70_SOYBN (Heat shock 70 kDa protein OS=Glycine max GN=HSP70 PE=3 SV=1)

HSP 1 Score: 203.371 bits (516), Expect = 7.293e-52
Identity = 106/146 (72.60%), Postives = 117/146 (80.14%), Query Frame = -2
Query:  160 KNKITITNDKGRLSKEEIEKMVQEAEKYKAEDDEHKKKVEAKNALENYAYNMRNTIKDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKELEGICNPIIAKMYQGGGADAGASMDEDXXXXXXXXXXXPKIEEVD 597
            KNKITITNDKGRLSKEEIEKMV++AE+YKAED+E KKKVEAKN+LENYAYNMRNTIKDEKI  KL   +K+KIE A+E+AIQWL+GNQ+AE DEFEDK KELEGICNPIIAKMYQG    AG   D             PKIEEVD
Sbjct:  503 KNKITITNDKGRLSKEEIEKMVKDAERYKAEDEEVKKKVEAKNSLENYAYNMRNTIKDEKIGGKLSPDEKQKIEKAVEDAIQWLEGNQMAEVDEFEDKQKELEGICNPIIAKMYQGA---AGPGGDVPMGADMPAAGAGPKIEEVD 645          
BLAST of CB304513 vs. ExPASy Swiss-Prot
Match: HSP70_DAUCA (Heat shock 70 kDa protein OS=Daucus carota GN=HSP70 PE=3 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 2.196e-48
Identity = 92/118 (77.97%), Postives = 105/118 (88.98%), Query Frame = -2
Query:  244 KNKITITNDKGRLSKEEIEKMVQEAEKYKAEDDEHKKKVEAKNALENYAYNMRNTIKDEKISAKLPTADKKKIEDAIEEAIQWLDGNQLAEADEFEDKMKELEGICNPIIAKMYQGGG 597
            KNKITITND GRLSK+EIEK+V+EAEKYKAED+E KKKVEAKNALENYAYNMRNTIKD+KI  KL   DK+KIE A+ EAI+WL+ NQLAE DE EDK+KELEG+CNPIIA++YQG G
Sbjct:  506 KNKITITNDNGRLSKDEIEKLVKEAEKYKAEDEEVKKKVEAKNALENYAYNMRNTIKDDKIPGKLDAGDKEKIETAVNEAIEWLEKNQLAEVDELEDKLKELEGLCNPIIARLYQGRG 623          
The following BLAST results are available for this feature:
BLAST of CB304513 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 200
Match NameE-valueIdentityDescription
HSP71_ARATH3.611e-5978.67Heat shock cognate 70 kDa protein 1 OS=Arabidopsis... [more]
HSP72_ARATH4.716e-5978.81Heat shock cognate 70 kDa protein 2 OS=Arabidopsis... [more]
HSP71_SOLLC3.993e-5878.08Heat shock cognate 70 kDa protein 1 OS=Solanum lyc... [more]
HSP72_SOLLC9.834e-5777.40Heat shock cognate 70 kDa protein 2 OS=Solanum lyc... [more]
HSP70_MAIZE1.284e-5676.71Heat shock 70 kDa protein OS=Zea mays GN=HSP70 PE=... [more]
HSP7E_SPIOL1.677e-5682.03Chloroplast envelope membrane 70 kDa heat shock-re... [more]
HSP7C_PETHY3.737e-5676.67Heat shock cognate 70 kDa protein OS=Petunia hybri... [more]
HSP73_ARATH2.422e-5576.35Heat shock cognate 70 kDa protein 3 OS=Arabidopsis... [more]
HSP70_SOYBN7.293e-5272.60Heat shock 70 kDa protein OS=Glycine max GN=HSP70 ... [more]
HSP70_DAUCA2.196e-4877.97Heat shock 70 kDa protein OS=Daucus carota GN=HSP7... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IIaR_H09 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IIaR_H09 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304513 ID=CB304513|Name=CB304513|organism=Citrus sinensis|type=EST|length=598bp
TTTTTTTTTTTTTTTTTTTTTTTTTGAAACATAATATCTTTATGCATACA
CCAGGAAACAGTATTTACATGTAACAGAAGCAGGAAAAGGAAGAAAAGAT
CACACTCCCAACTCAACCCCTAATCATTAAACAACATTAAGCATAAATCC
TCAAATTTAATCCACCTCCTCAATCTTGGGGCCAGCACCGCTACCAGCAC
CAGCAGAAGGACCATCCTCATCCATACTTGCACCAGCATCAGCTCCACCT
CCTTGGTACATCTTGGCAATAATTGGGTTGCAGATGCCCTCCAGCTCTTT
CATCTTATCTTCAAACTCATCTGCCTCTGCGAGCTGGTTCCCGTCAAGCC
ATTGGATGGCCTCCTCAATGGCATCTTCAATTTTCTTCTTGTCAGCAGTG
GGAAGCTTTGCGCTGATCTTTTCATCCTTGATTGTGTTTCTCATGTTGTA
AGCATAATTCTCGAGAGCATTCTTGGCCTCCACCTTTTTCTTGTGCTCGT
CATCCTCGGCCTTGTATTTTTCTGCCTCTTGTACCATCTTCTCTATCTCC
TCCTTAGAGAGTCTGCCCTTGTCATTTGTGATGGTAATCTTATTCTTC
back to top