CB304528

Overview
NameCB304528
Unique NameCB304528
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length563
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10531 contig Csv1_Contig10531:433..995. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304528 vs. ExPASy Swiss-Prot
Match: Y1736_ARATH (REF/SRPP-like protein At1g67360 OS=Arabidopsis thaliana GN=At1g67360 PE=2 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 4.624e-26
Identity = 53/96 (55.21%), Postives = 70/96 (72.92%), Query Frame = -2
Query:  275 ETQKLVIEAQTGGPRAAVHYAAAEFKHLLLTNSVKAWYKLNHYALFHTMADMAVPTAAQWSKKYNHLVVEMTKKGYTVFGYLPLVPIDDIAKAFKQ 562
            + Q  V EA+TGGP+AA +YAA E+K  ++TNSVK W KLN Y   H M D A+P AA +S +YN LV +MT  GY++ GYLPLVP+DDI KA+++
Sbjct:  113 KAQSFVKEARTGGPKAAFNYAATEYKFFVVTNSVKVWAKLNQYKPIHAMGDKALPVAAHFSSRYNDLVTDMTNMGYSLVGYLPLVPVDDIVKAYEK 208          
BLAST of CB304528 vs. ExPASy Swiss-Prot
Match: Y3550_ARATH (REF/SRPP-like protein At3g05500 OS=Arabidopsis thaliana GN=At3g05500 PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 5.488e-11
Identity = 33/64 (51.56%), Postives = 43/64 (67.19%), Query Frame = -2
Query:  275 SVKAWYKLNHYALFHTMADMAVPTAAQWSKKYNHLVVEMTKKGYTVFGYLPLVPIDDIAKAFKQ 466
            +V AW KLN   LF  +A +AVPTAA  S+KYN  VV+  +KGY V  Y+PLVP + I+K F +
Sbjct:  169 AVSAWKKLNQLPLFPRLAQVAVPTAAFCSEKYNDTVVKAAEKGYRVTSYMPLVPTERISKIFAE 232          
BLAST of CB304528 vs. ExPASy Swiss-Prot
Match: SRP_VITRI (Stress-related protein OS=Vitis riparia GN=SRP PE=2 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 5.488e-11
Identity = 32/63 (50.79%), Postives = 41/63 (65.08%), Query Frame = -2
Query:  278 SVKAWYKLNHYALFHTMADMAVPTAAQWSKKYNHLVVEMTKKGYTVFGYLPLVPIDDIAKAFK 466
            +V AW  LN   LF  +A + VPTAA WS+KYN  V    ++GYTV  YLPL+P + IAK F+
Sbjct:  167 AVSAWRSLNRLPLFPQVAQVVVPTAAYWSEKYNQSVSYTAERGYTVALYLPLIPTERIAKVFQ 229          
The following BLAST results are available for this feature:
BLAST of CB304528 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 3
Match NameE-valueIdentityDescription
Y1736_ARATH4.624e-2655.21REF/SRPP-like protein At1g67360 OS=Arabidopsis tha... [more]
Y3550_ARATH5.488e-1151.56REF/SRPP-like protein At3g05500 OS=Arabidopsis tha... [more]
SRP_VITRI5.488e-1150.79Stress-related protein OS=Vitis riparia GN=SRP PE=... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IVaR_B08 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IVaR_B08 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304528 ID=CB304528|Name=CB304528|organism=Citrus sinensis|type=EST|length=563bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTGAATTTATGAACCATTTATC
TCCATTCACATATGGGGAAAACCAAGTCTTAAAGGTCATTTACAGATTAC
AAACCATAGTGCCACCACCCGGCCACACCTTCAAGCCTAAAATTTTGAAA
ACCAGACCACTAAATGAAGCAAACTCATCAAACAAAAAGTAAATTCTTAG
TCAGAATCTGAGCTTGAATCCTTTTCCTTTGCATCTTCTTTCTCTGGAGC
ATCTTCTTTCTTGGGAGCTTCACTCTGCTTAAAAGCTTTGGCTATGTCAT
CAATGGGAACCAAAGGAAGATAGCCAAAGACTGTGTAACCCTTCTTCGTC
ATCTCCACGACAAGATGGTTATACTTCTTGGACCACTGTGCAGCTGTGGG
AACAGCCATATCTGCCATTGTGTGGAACAATGCATAGTGGTTTAGTTTAT
ACCATGCTTTCACGGAATTTGTTAGCAGAAGGTGTTTAAACTCAGCAGCA
GCATAATGGACAGCTGCTCGAGGCCCCCCGGTTTGGGCCTCAATCACAAG
CTTTTGAGTTTCT
back to top