CB304557

Overview
NameCB304557
Unique NameCB304557
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length507
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2641 contig Csv1_Contig2641:327..831. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304557 vs. ExPASy Swiss-Prot
Match: MT3_CARPA (Metallothionein-like protein type 3 OS=Carica papaya PE=3 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 7.337e-19
Identity = 39/60 (65.00%), Postives = 47/60 (78.33%), Query Frame = -2
Query:  327 NCDCVDRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPPCACVNCTCG 506
            NCDC D++QCVKKGSSY AD +ET+ S ++  VVMD  AAE +G CKCGP C+C NCTCG
Sbjct:    7 NCDCADKTQCVKKGSSYTADIIETEKSIMT--VVMDAPAAENDGKCKCGPSCSCTNCTCG 64          
BLAST of CB304557 vs. ExPASy Swiss-Prot
Match: MT3_MUSAC (Metallothionein-like protein type 3 OS=Musa acuminata PE=3 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 5.258e-17
Identity = 37/61 (60.66%), Postives = 46/61 (75.41%), Query Frame = -2
Query:  324 NCDCVDRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPPCACVNCTCGS 506
            NCDCVD+SQCVKKG+SY  D VET+ S+V  V+V   +AAE +G CKCG  CAC +C CG+
Sbjct:    6 NCDCVDKSQCVKKGNSYGIDIVETEKSYVDEVIVA-AEAAEHDGKCKCGAACACTDCKCGN 65          
BLAST of CB304557 vs. ExPASy Swiss-Prot
Match: MT3_ACTDE (Metallothionein-like protein type 3 OS=Actinidia deliciosa GN=pKIWI503 PE=2 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 8.395e-15
Identity = 38/59 (64.41%), Postives = 42/59 (71.19%), Query Frame = -2
Query:  330 NCDCVDRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPPCACVNCTC 506
            NCDC D SQCVKKG+S   D VETD S++  VV M V AAE+ G CKCG  C CVNCTC
Sbjct:    7 NCDCADSSQCVKKGNSI--DIVETDKSYIEDVV-MGVPAAESGGKCKCGTSCPCVNCTC 62          
BLAST of CB304557 vs. ExPASy Swiss-Prot
Match: MT3_MALDO (Metallothionein-like protein type 3 OS=Malus domestica GN=MT2 PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 3.190e-14
Identity = 35/60 (58.33%), Postives = 42/60 (70.00%), Query Frame = -2
Query:  327 NCDCVDRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPPCACVNCTCG 506
            NCDC D +QCVKKG+SY    VET+   + TV V D  AAE +G CKCG  C+CV+CTCG
Sbjct:    7 NCDCADSTQCVKKGNSYDLVIVETENRSMDTVFV-DAPAAEHDGKCKCGTGCSCVSCTCG 65          
BLAST of CB304557 vs. ExPASy Swiss-Prot
Match: MT3_PRUAV (Metallothionein-like protein 1 OS=Prunus avium GN=MT1 PE=3 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 7.107e-14
Identity = 35/59 (59.32%), Postives = 40/59 (67.80%), Query Frame = -2
Query:  330 NCDCVDRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPPCACVNCTC 506
            NCDC D SQC KKG S+    VET+   + TV+ MD  AAE  GNCKCGP CACV+C C
Sbjct:    7 NCDCSDSSQCTKKGYSFDLVIVETENRSMDTVI-MDAPAAENGGNCKCGPSCACVDCKC 64          
BLAST of CB304557 vs. ExPASy Swiss-Prot
Match: MT3A_ORYSJ (Metallothionein-like protein 3A OS=Oryza sativa subsp. japonica GN=MT3A PE=2 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 8.688e-12
Identity = 30/60 (50.00%), Postives = 36/60 (60.00%), Query Frame = -2
Query:  327 NCDCVDRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPPCACVNCTCG 506
            NCDC D+SQCVKKG+SY    VE + S        +V A E  G CKCG  C+C +C CG
Sbjct:    7 NCDCADKSQCVKKGTSYGVVIVEAEKSHFE-----EVAAGEENGGCKCGTSCSCTDCKCG 61          
BLAST of CB304557 vs. ExPASy Swiss-Prot
Match: MT3A_ORYSI (Metallothionein-like protein 3A OS=Oryza sativa subsp. indica GN=MT3A PE=3 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 8.688e-12
Identity = 30/60 (50.00%), Postives = 36/60 (60.00%), Query Frame = -2
Query:  327 NCDCVDRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPPCACVNCTCG 506
            NCDC D+SQCVKKG+SY    VE + S        +V A E  G CKCG  C+C +C CG
Sbjct:    7 NCDCADKSQCVKKGTSYGVVIVEAEKSHFE-----EVAAGEENGGCKCGTSCSCTDCKCG 61          
The following BLAST results are available for this feature:
BLAST of CB304557 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
MT3_CARPA7.337e-1965.00Metallothionein-like protein type 3 OS=Carica papa... [more]
MT3_MUSAC5.258e-1760.66Metallothionein-like protein type 3 OS=Musa acumin... [more]
MT3_ACTDE8.395e-1564.41Metallothionein-like protein type 3 OS=Actinidia d... [more]
MT3_MALDO3.190e-1458.33Metallothionein-like protein type 3 OS=Malus domes... [more]
MT3_PRUAV7.107e-1459.32Metallothionein-like protein 1 OS=Prunus avium GN=... [more]
MT3A_ORYSJ8.688e-1250.00Metallothionein-like protein 3A OS=Oryza sativa su... [more]
MT3A_ORYSI8.688e-1250.00Metallothionein-like protein 3A OS=Oryza sativa su... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0001_IVaR_E08 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0001_IVaR_E08 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304557 ID=CB304557|Name=CB304557|organism=Citrus sinensis|type=EST|length=507bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTGGGAGAGTTGGCTGGAGAC
TAACAATAATACATTAAAATTAAACCACACAAGGGCACGGGCATGGCCAT
GGCCATATATTACATGATTATGAAGAAGGAAACACAAAACATTACGAGTG
ATGGGTGACACAACACGCACATCACTCCACACACTAATAGTAAACCATCA
TAAAAACGAAGTAAAGAATTTTTCTTTTTTTTTTTAATCACCCTTACATT
ATTCTTAACCCCCACAATATTTAGGCACACTTGCAGCTTCTTATTTTTTG
CTGCATGGGTTTGCTTATTAATGACTACCACAAGTGCAGTTCACACAAGC
GCAGGGGGGGCCGCACTTGCAGTTACCTTCAGCCTCAGCAGCCTGAACGT
CCATGACAACAACGGTGCTGACAAAGCTCAAGTCAGTCTCGACGAAATCA
GCAGCATAACTGCTTCCCTTCTTCACACACTGGCTCCTGTCAACGCAATC
GCAGTTG
back to top