CB304668

Overview
NameCB304668
Unique NameCB304668
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length539
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9763 contig Csv1_Contig9763:541..1078. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304668 vs. ExPASy Swiss-Prot
Match: MTF1_PEA (MADS-box transcription factor 1 OS=Pisum sativum GN=MTF1 PE=2 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 7.569e-20
Identity = 52/84 (61.90%), Postives = 57/84 (67.86%), Query Frame = -3
Query:  280 LRHADFAGLQLMEGYQVNTLQLNPSAEDCGYGLK-PAQPQGDTFFHA--LECEPTLQIGYQPADPISVVTAGPSLNNYMQGWLP 522
            L  A+ A  Q MEGYQ+N+LQLN SAED GYG        GD  F    +ECEPTLQIGY   DP SVVTAGPS+NNYM GWLP
Sbjct:  164 LCEANRALRQRMEGYQINSLQLNLSAEDMGYGRHHQGHTHGDELFQVQPIECEPTLQIGYHQGDPGSVVTAGPSMNNYMGGWLP 247          
BLAST of CB304668 vs. ExPASy Swiss-Prot
Match: AGL9_PETHY (Agamous-like MADS-box protein AGL9 homolog OS=Petunia hybrida GN=FBP2 PE=1 SV=2)

HSP 1 Score: 92.4337 bits (228), Expect = 1.428e-18
Identity = 47/72 (65.28%), Postives = 54/72 (75.00%), Query Frame = -3
Query:  280 QLMEGYQVNTLQLNPSAEDCGYGLKPAQPQGDTFFHALECEPTLQIGYQPADPISVVTAGPSLNNYMQGWLP 495
            +LMEG  +N LQ   +A+D GYG +  Q QGD FFH LECEPTLQIGYQ  DPI+V  AGPS+NNYM GWLP
Sbjct:  172 RLMEGSTLN-LQWQQNAQDVGYGRQATQTQGDGFFHPLECEPTLQIGYQ-NDPITVGGAGPSVNNYMAGWLP 241          
The following BLAST results are available for this feature:
BLAST of CB304668 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 2
Match NameE-valueIdentityDescription
MTF1_PEA7.569e-2061.90MADS-box transcription factor 1 OS=Pisum sativum G... [more]
AGL9_PETHY1.428e-1865.28Agamous-like MADS-box protein AGL9 homolog OS=Petu... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0002_IIIaR_B10 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0002_IIIaR_B10 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304668 ID=CB304668|Name=CB304668|organism=Citrus sinensis|type=EST|length=539bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTCATTCTCAAACAAGGCTTTG
TTAAATAAAGATAAGCGCGGGGATTGAAAATACACGCACACACAACATAG
CTATATATCGTCATCAGTTTCCCTAAAGTGCAGGATCACTGTAGAGTTAT
TATAATAAATCCTTATGATTGCGTGTTCCTAGTCACTGAATAGGGTTGCT
TACAAAGGGATACAAAGTTGCTGATTCTTATGGATCAACTGCAATACATT
GACTGGTAATGCCCGCCGCTCTCTTAGCATGGTAGCCATCCTTGCATGTA
ATTATTCAGACTCGGGCCTGCTGTGACAACCGATATTGGGTCCGCAGGCT
GGTATCCAATTTGCAATGTGGGTTCACATTCCAAGGCGTGAAAGAAGGTA
TCGCCCTGAGGTTGAGCTGGTTTAAGCCCATAACCACAATCTTCTGCACT
AGGATTCAATTGAAGTGTGTTCACTTGGTATCCCTCCATCAACTGCAAAC
CAGCAAAATCGGCGTGCCTTAGCGTCATCGTCCTTTGTT
back to top