CB304673

Overview
NameCB304673
Unique NameCB304673
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length640
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2117 contig Csv1_Contig2117:213..852. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304673 vs. ExPASy Swiss-Prot
Match: RS15_ELAOL (40S ribosomal protein S15 OS=Elaeis oleifera GN=RPS15 PE=2 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 4.410e-61
Identity = 115/119 (96.64%), Postives = 116/119 (97.48%), Query Frame = -1
Query:  284 DMSNDELVKLFSARARRRFQRGLKRKPMALIKKLRKAKREAPPGEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 640
            DM  DELVKLF ARARRRFQRGLKRKPMALIKKLRKAKR+APPGEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK
Sbjct:   35 DMGTDELVKLFHARARRRFQRGLKRKPMALIKKLRKAKRDAPPGEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 153          
BLAST of CB304673 vs. ExPASy Swiss-Prot
Match: RS15_PICMA (40S ribosomal protein S15 OS=Picea mariana GN=RPS15 PE=2 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 8.316e-60
Identity = 113/119 (94.96%), Postives = 117/119 (98.32%), Query Frame = -1
Query:  284 DMSNDELVKLFSARARRRFQRGLKRKPMALIKKLRKAKREAPPGEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 640
            DM+++ELVKLF ARARRRFQRGLKR+PMALIKKLRKAKREAP GEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK
Sbjct:   33 DMTSEELVKLFHARARRRFQRGLKRQPMALIKKLRKAKREAPSGEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 151          
BLAST of CB304673 vs. ExPASy Swiss-Prot
Match: RS15_ORYSJ (40S ribosomal protein S15 OS=Oryza sativa subsp. japonica GN=RPS15 PE=2 SV=2)

HSP 1 Score: 228.409 bits (581), Expect = 2.420e-59
Identity = 111/119 (93.28%), Postives = 116/119 (97.48%), Query Frame = -1
Query:  284 DMSNDELVKLFSARARRRFQRGLKRKPMALIKKLRKAKREAPPGEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 640
            DMS D+LV+LF ARARRRFQRGLKRKPMALIKKLRKAK++AP GEKPEPVRTHLRNMIIVPEMIGSI+GVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK
Sbjct:   36 DMSTDDLVQLFPARARRRFQRGLKRKPMALIKKLRKAKKDAPAGEKPEPVRTHLRNMIIVPEMIGSIVGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 154          
BLAST of CB304673 vs. ExPASy Swiss-Prot
Match: RS154_ARATH (40S ribosomal protein S15-4 OS=Arabidopsis thaliana GN=RPS15D PE=2 SV=1)

HSP 1 Score: 226.868 bits (577), Expect = 7.040e-59
Identity = 111/119 (93.28%), Postives = 114/119 (95.80%), Query Frame = -1
Query:  284 DMSNDELVKLFSARARRRFQRGLKRKPMALIKKLRKAKREAPPGEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 640
            DMS D+LVKLFS+R RRRF RGL RKPMALIKKLRKAKREAP GEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPG+GATHSSRFIPLK
Sbjct:   34 DMSTDDLVKLFSSRIRRRFSRGLTRKPMALIKKLRKAKREAPAGEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPGVGATHSSRFIPLK 152          
BLAST of CB304673 vs. ExPASy Swiss-Prot
Match: RS151_ARATH (40S ribosomal protein S15-1 OS=Arabidopsis thaliana GN=RPS15A PE=1 SV=1)

HSP 1 Score: 226.868 bits (577), Expect = 7.040e-59
Identity = 111/119 (93.28%), Postives = 114/119 (95.80%), Query Frame = -1
Query:  284 DMSNDELVKLFSARARRRFQRGLKRKPMALIKKLRKAKREAPPGEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 640
            DMS D+LVKLFS+R RRRF RGL RKPMALIKKLRKAKREAP GEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPG+GATHSSRFIPLK
Sbjct:   34 DMSTDDLVKLFSSRIRRRFSRGLTRKPMALIKKLRKAKREAPQGEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPGVGATHSSRFIPLK 152          
BLAST of CB304673 vs. ExPASy Swiss-Prot
Match: RS153_ARATH (40S ribosomal protein S15-3 OS=Arabidopsis thaliana GN=RPS15C PE=2 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 8.055e-55
Identity = 105/119 (88.24%), Postives = 110/119 (92.44%), Query Frame = -1
Query:  284 DMSNDELVKLFSARARRRFQRGLKRKPMALIKKLRKAKREAPPGEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 640
            DMS D+LVKLF +R RRRF RGL RKPMALIKKLRKAK EAP GEKP  VRTHLRNMIIVPEMIGS+IGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPG+GAT+SSRFIPLK
Sbjct:   32 DMSTDDLVKLFPSRIRRRFSRGLTRKPMALIKKLRKAKIEAPAGEKPAAVRTHLRNMIIVPEMIGSVIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPGVGATNSSRFIPLK 150          
BLAST of CB304673 vs. ExPASy Swiss-Prot
Match: RS155_ARATH (40S ribosomal protein S15-5 OS=Arabidopsis thaliana GN=RPS15E PE=2 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 3.998e-54
Identity = 105/119 (88.24%), Postives = 110/119 (92.44%), Query Frame = -1
Query:  284 DMSNDELVKLFSARARRRFQRGLKRKPMALIKKLRKAKREAPPGEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 640
            DMS ++LVK FS+R RRRF RGL RKPMALIKKLRKAK EAP GEKP  VRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPG+GAT+SSRFIPLK
Sbjct:   31 DMSIEDLVKHFSSRIRRRFSRGLTRKPMALIKKLRKAKMEAPAGEKPASVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPGVGATNSSRFIPLK 149          
BLAST of CB304673 vs. ExPASy Swiss-Prot
Match: RS152_ARATH (40S ribosomal protein S15-2 OS=Arabidopsis thaliana GN=RPS15B PE=2 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 4.887e-52
Identity = 98/119 (82.35%), Postives = 108/119 (90.76%), Query Frame = -1
Query:  284 DMSNDELVKLFSARARRRFQRGLKRKPMALIKKLRKAKREAPPGEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 640
            DM  D+LV+LF +R RRR  RGL RKPMALIKKLRKAK +AP GEKPE VRTHLRNM+I+PEMIGSIIGVYNGKTFNQ+EIKPEMIGHYLAEFSI+YKPV+HG+PG GATHSSRFIPLK
Sbjct:   34 DMPTDDLVELFPSRIRRRMSRGLTRKPMALIKKLRKAKLDAPAGEKPEVVRTHLRNMVIMPEMIGSIIGVYNGKTFNQIEIKPEMIGHYLAEFSITYKPVRHGKPGHGATHSSRFIPLK 152          
BLAST of CB304673 vs. ExPASy Swiss-Prot
Match: RS15_RAT (40S ribosomal protein S15 OS=Rattus norvegicus GN=Rps15 PE=1 SV=2)

HSP 1 Score: 198.364 bits (503), Expect = 2.681e-50
Identity = 93/119 (78.15%), Postives = 110/119 (92.44%), Query Frame = -1
Query:  284 DMSNDELVKLFSARARRRFQRGLKRKPMALIKKLRKAKREAPPGEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 640
            DMS ++L++L+SAR RRR  RGL+RK  +L+K+LRKAK+EAPP EKPE V+THLR+MII+PEM+GS++GVYNGKTFNQVEIKPEMIGHYL EFSI+YKPVKHGRPGIGATHSSRFIPLK
Sbjct:   27 DMSYEQLMQLYSARQRRRLNRGLRRKQHSLLKRLRKAKKEAPPMEKPEVVKTHLRDMIILPEMVGSMVGVYNGKTFNQVEIKPEMIGHYLGEFSITYKPVKHGRPGIGATHSSRFIPLK 145          
BLAST of CB304673 vs. ExPASy Swiss-Prot
Match: RS15_PONAB (40S ribosomal protein S15 OS=Pongo abelii GN=RPS15 PE=2 SV=3)

HSP 1 Score: 198.364 bits (503), Expect = 2.681e-50
Identity = 93/119 (78.15%), Postives = 110/119 (92.44%), Query Frame = -1
Query:  284 DMSNDELVKLFSARARRRFQRGLKRKPMALIKKLRKAKREAPPGEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK 640
            DMS ++L++L+SAR RRR  RGL+RK  +L+K+LRKAK+EAPP EKPE V+THLR+MII+PEM+GS++GVYNGKTFNQVEIKPEMIGHYL EFSI+YKPVKHGRPGIGATHSSRFIPLK
Sbjct:   27 DMSYEQLMQLYSARQRRRLNRGLRRKQHSLLKRLRKAKKEAPPMEKPEVVKTHLRDMIILPEMVGSMVGVYNGKTFNQVEIKPEMIGHYLGEFSITYKPVKHGRPGIGATHSSRFIPLK 145          
The following BLAST results are available for this feature:
BLAST of CB304673 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 83
Match NameE-valueIdentityDescription
RS15_ELAOL4.410e-6196.6440S ribosomal protein S15 OS=Elaeis oleifera GN=RP... [more]
RS15_PICMA8.316e-6094.9640S ribosomal protein S15 OS=Picea mariana GN=RPS1... [more]
RS15_ORYSJ2.420e-5993.2840S ribosomal protein S15 OS=Oryza sativa subsp. j... [more]
RS154_ARATH7.040e-5993.2840S ribosomal protein S15-4 OS=Arabidopsis thalian... [more]
RS151_ARATH7.040e-5993.2840S ribosomal protein S15-1 OS=Arabidopsis thalian... [more]
RS153_ARATH8.055e-5588.2440S ribosomal protein S15-3 OS=Arabidopsis thalian... [more]
RS155_ARATH3.998e-5488.2440S ribosomal protein S15-5 OS=Arabidopsis thalian... [more]
RS152_ARATH4.887e-5282.3540S ribosomal protein S15-2 OS=Arabidopsis thalian... [more]
RS15_RAT2.681e-5078.1540S ribosomal protein S15 OS=Rattus norvegicus GN=... [more]
RS15_PONAB2.681e-5078.1540S ribosomal protein S15 OS=Pongo abelii GN=RPS15... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0002_IIIaR_C04 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0002_IIIaR_C04 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304673 ID=CB304673|Name=CB304673|organism=Citrus sinensis|type=EST|length=640bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTGCCAAAATATGAAATAATTG
GCAGTGCCGTATGAAAACAAACACAACTTTTGGCTGACATAAGAATACAC
TCATATCCAAGCCACATAACACCTCTTTAAACTACACATTAGTTCCATTA
TCTAGATTAACAACTCAAACGCTAGTATTTAGTCCAACAACCAAAAAAAT
GTAACCACAAAAAATTTGATCAACTTCAATGTTTTCTGAAAATAACAATA
AGCTAAAATTCCAGATATCCAGCATACATCTCACTTAAGAGGAATGAACC
TTGAGGAATGGGTAGCACCAATACCAGGTCTACCGTGCTTCACAGGCTTG
TATGAGATAGAGAACTCAGCCAGGTAATGCCCAATCATTTCCGGCTTGAT
TTCAACCTGATTAAAGGTCTTGCCATTGTACACTCCAATAATGCTTCCAA
TCATTTCAGGAACAATGATCATGTTTCGCAAATGGGTGCGAACTGGTTCA
GGCTTCTCACCAGGCGGAGCCTCCCTTTTCGCCTTGCGAAGCTTCTTGAT
CAAAGCCATGGGCTTCCTCTTTAAACCCCTCTGAAACCTTCTGCGCGCAC
GTGCACTGAAGAGCTTGACGAGCTCATCATTGGACATATC
back to top