CB304748

Overview
NameCB304748
Unique NameCB304748
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length578
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB304748 vs. ExPASy Swiss-Prot
Match: UBL5_ARATH (Ubiquitin-like protein 5 OS=Arabidopsis thaliana GN=UBL5 PE=1 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 1.272e-34
Identity = 69/73 (94.52%), Postives = 72/73 (98.63%), Query Frame = -2
Query:  308 MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLKDYEIHDGMGPELYYS 526
            MIEVVLNDRLGKKVRVKCN+DDTIGDLKKLVAAQTGTRA+KIRIQKWYNIYKDHITLKDYEIHDGMG ELYY+
Sbjct:    1 MIEVVLNDRLGKKVRVKCNDDDTIGDLKKLVAAQTGTRAEKIRIQKWYNIYKDHITLKDYEIHDGMGLELYYN 73          
BLAST of CB304748 vs. ExPASy Swiss-Prot
Match: UBL5_PSAOB (Ubiquitin-like protein 5 OS=Psammomys obesus GN=UBL5 PE=3 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.153e-27
Identity = 57/72 (79.17%), Postives = 64/72 (88.89%), Query Frame = -2
Query:  311 MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLKDYEIHDGMGPELYY 526
            MIEVV NDRLGKKVRVKCN DDTIGDLKKL+AAQTGTR +KI ++KWY I+KDH++L DYEIHDGM  ELYY
Sbjct:    1 MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYY 72          
BLAST of CB304748 vs. ExPASy Swiss-Prot
Match: UBL5_MOUSE (Ubiquitin-like protein 5 OS=Mus musculus GN=Ubl5 PE=1 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.153e-27
Identity = 57/72 (79.17%), Postives = 64/72 (88.89%), Query Frame = -2
Query:  311 MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLKDYEIHDGMGPELYY 526
            MIEVV NDRLGKKVRVKCN DDTIGDLKKL+AAQTGTR +KI ++KWY I+KDH++L DYEIHDGM  ELYY
Sbjct:    1 MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYY 72          
BLAST of CB304748 vs. ExPASy Swiss-Prot
Match: UBL5_MESAU (Ubiquitin-like protein 5 OS=Mesocricetus auratus GN=UBL5 PE=3 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.153e-27
Identity = 57/72 (79.17%), Postives = 64/72 (88.89%), Query Frame = -2
Query:  311 MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLKDYEIHDGMGPELYY 526
            MIEVV NDRLGKKVRVKCN DDTIGDLKKL+AAQTGTR +KI ++KWY I+KDH++L DYEIHDGM  ELYY
Sbjct:    1 MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYY 72          
BLAST of CB304748 vs. ExPASy Swiss-Prot
Match: UBL5_HUMAN (Ubiquitin-like protein 5 OS=Homo sapiens GN=UBL5 PE=1 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.153e-27
Identity = 57/72 (79.17%), Postives = 64/72 (88.89%), Query Frame = -2
Query:  311 MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLKDYEIHDGMGPELYY 526
            MIEVV NDRLGKKVRVKCN DDTIGDLKKL+AAQTGTR +KI ++KWY I+KDH++L DYEIHDGM  ELYY
Sbjct:    1 MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYY 72          
BLAST of CB304748 vs. ExPASy Swiss-Prot
Match: UBL5_BOVIN (Ubiquitin-like protein 5 OS=Bos taurus GN=UBL5 PE=3 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.153e-27
Identity = 57/72 (79.17%), Postives = 64/72 (88.89%), Query Frame = -2
Query:  311 MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLKDYEIHDGMGPELYY 526
            MIEVV NDRLGKKVRVKCN DDTIGDLKKL+AAQTGTR +KI ++KWY I+KDH++L DYEIHDGM  ELYY
Sbjct:    1 MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYY 72          
BLAST of CB304748 vs. ExPASy Swiss-Prot
Match: UBL5_DANRE (Ubiquitin-like protein 5 OS=Danio rerio GN=ubl5 PE=3 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 4.382e-27
Identity = 55/72 (76.39%), Postives = 65/72 (90.28%), Query Frame = -2
Query:  311 MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLKDYEIHDGMGPELYY 526
            MIEVV NDRLGKKVRVKCN++DTIGDLKKL+AAQTGTR +KI ++KWY I+K+H++L DYEIHDGM  ELYY
Sbjct:    1 MIEVVCNDRLGKKVRVKCNQEDTIGDLKKLIAAQTGTRWEKIVLKKWYTIFKNHVSLGDYEIHDGMNLELYY 72          
BLAST of CB304748 vs. ExPASy Swiss-Prot
Match: UBL5_CAEEL (Ubiquitin-like protein 5 OS=Caenorhabditis elegans GN=ubl-5 PE=2 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 1.275e-26
Identity = 54/72 (75.00%), Postives = 62/72 (86.11%), Query Frame = -2
Query:  311 MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLKDYEIHDGMGPELYY 526
            MIE+ +NDRLGKKVR+KCN  DTIGDLKKL+AAQTGTR +KI ++KWY IYKDHITL DYEIH+G   ELYY
Sbjct:    1 MIEITVNDRLGKKVRIKCNPSDTIGDLKKLIAAQTGTRWEKIVLKKWYTIYKDHITLMDYEIHEGFNFELYY 72          
BLAST of CB304748 vs. ExPASy Swiss-Prot
Match: UBL5_DROME (Ubiquitin-like protein 5 OS=Drosophila melanogaster GN=ubl PE=3 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 6.327e-26
Identity = 54/72 (75.00%), Postives = 61/72 (84.72%), Query Frame = -2
Query:  311 MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLKDYEIHDGMGPELYY 526
            MIE+  NDRLGKKVRVKCN DDTIGDLKKL+AAQTGT+ +KI ++KWY I+KD I L DYEIHDGM  ELYY
Sbjct:    1 MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTKHEKIVLKKWYTIFKDPIRLSDYEIHDGMNLELYY 72          
BLAST of CB304748 vs. ExPASy Swiss-Prot
Match: HUB1_SCHPO (Ubiquitin-like modifier hub1 OS=Schizosaccharomyces pombe GN=hub1 PE=1 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 3.472e-24
Identity = 51/73 (69.86%), Postives = 62/73 (84.93%), Query Frame = -2
Query:  308 MIEVVLNDRLGKKVRVKCNEDDTIGDLKKLVAAQTGTRADKIRIQKWYNIYKDHITLKDYEIHDGMGPELYYS 526
            MIEV+ NDRLGKKVRVKC  DDT+GD KKLVAAQTGT   +I ++KW++++KD+ITL DYEIHDGM  E+YYS
Sbjct:    1 MIEVLCNDRLGKKVRVKCMPDDTVGDFKKLVAAQTGTDPRRIVLKKWHSVFKDNITLADYEIHDGMSLEMYYS 73          
The following BLAST results are available for this feature:
BLAST of CB304748 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 16
Match NameE-valueIdentityDescription
UBL5_ARATH1.272e-3494.52Ubiquitin-like protein 5 OS=Arabidopsis thaliana G... [more]
UBL5_PSAOB1.153e-2779.17Ubiquitin-like protein 5 OS=Psammomys obesus GN=UB... [more]
UBL5_MOUSE1.153e-2779.17Ubiquitin-like protein 5 OS=Mus musculus GN=Ubl5 P... [more]
UBL5_MESAU1.153e-2779.17Ubiquitin-like protein 5 OS=Mesocricetus auratus G... [more]
UBL5_HUMAN1.153e-2779.17Ubiquitin-like protein 5 OS=Homo sapiens GN=UBL5 P... [more]
UBL5_BOVIN1.153e-2779.17Ubiquitin-like protein 5 OS=Bos taurus GN=UBL5 PE=... [more]
UBL5_DANRE4.382e-2776.39Ubiquitin-like protein 5 OS=Danio rerio GN=ubl5 PE... [more]
UBL5_CAEEL1.275e-2675.00Ubiquitin-like protein 5 OS=Caenorhabditis elegans... [more]
UBL5_DROME6.327e-2675.00Ubiquitin-like protein 5 OS=Drosophila melanogaste... [more]
HUB1_SCHPO3.472e-2469.86Ubiquitin-like modifier hub1 OS=Schizosaccharomyce... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0002_IIaR_C10 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0002_IIaR_C10 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304748 ID=CB304748; Name=CB304748; organism=Citrus sinensis; type=EST; length=578bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTCGACAAAATTCTATCAGCCTA
ATGGACTGACAAGCATGTGGTACCTCAATACCTTGATAAAGATCTAAACA
CCATTCAAAATGGAGAGTAAGTCCAGATCCCAGATATGTTACATAACCAC
AAATAAGTTTTTACGAGTCTTCACAAATTTTTTCTTACAAGACAGTATTA
GTAAAGTTGGCCCTGCCGCATCTTCCAATACCCCTTGCTTATTATAGCAT
ATGGTTCCTAGTAGTATTGACTGCTTGCAGCAGCATATATATTTAACGGT
GGATTTAGCTGTAATAGAGTTCAGGGCCCATGCCGTCGTGAATCTCGTAG
TCCTTGAGAGTGATGTGGTCCTTGTAGATGTTGTACCACTTCTGAATCCG
AATCTTGTCGGCTCGAGTCCCGGTCTGAGCCGCCACCAGCTTCTTCAAGT
CGCCTATGGTGTCGTCTTCGTTGCACTTCACGCGCACCTTCTTCCCGAGC
CTGTCGTTCAGCACCACCTCAATCATCTTTGTCTCCTGTTTTGATTTTCC
CTGCCGAATGATTTGGGATTTTCTCCCC
back to top