CB304783

Overview
NameCB304783
Unique NameCB304783
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length630
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5695 contig Csv1_Contig5695:235..864. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304783 vs. ExPASy Swiss-Prot
Match: ELI_PEA (Early light-induced protein, chloroplastic OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.199e-39
Identity = 81/119 (68.07%), Postives = 95/119 (79.83%), Query Frame = -2
Query:  225 TKAPRISTKFSDVFAFSGPAPERINGRLAMIGFVAALAVELSKGQDVFAQLSDGGVAWFLGTXXXXXXXXXVPLFKGVSVEFKSDGFMTSDAELWNGRFAMMGLVALAVTEFVKGSTLV 581
            T+ P++STKFSD+ AFSGPAPERINGRLAMIGFVAA+ VE++KGQ +  QLS GGVAWFLGT         +P F+GVSVE KS   M+SDAE WNGR AM+GLVALA TEFVKG++LV
Sbjct:   78 TRPPKMSTKFSDLMAFSGPAPERINGRLAMIGFVAAMGVEIAKGQGLSEQLSGGGVAWFLGTSVLLSLASLIPFFQGVSVESKSKSIMSSDAEFWNGRIAMLGLVALAFTEFVKGTSLV 196          
BLAST of CB304783 vs. ExPASy Swiss-Prot
Match: DS22_CRAPL (Desiccation stress protein DSP-22, chloroplastic OS=Craterostigma plantagineum GN=DSP-22 PE=2 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 1.420e-32
Identity = 74/140 (52.86%), Postives = 97/140 (69.29%), Query Frame = -2
Query:  225 KNEQQKDNQ---------LTTKAPRISTKFS-DVFAFSGPAPERINGRLAMIGFVAALAVELSKGQDVFAQLSDGGVAWFLGTXXXXXXXXXVPLFKGVSVEFKSDGFMTSDAELWNGRFAMMGLVALAVTEFVKGSTLV 614
            K EQQ+  Q         LT     ++TK + D+F+F G APERINGR AMIGFVAA+ VEL+ G+DVF+Q+ +GGV WFL T         +P+++G+S E K++GF  SDAE+WNGRFAM+GLVALA TE+VKG  L+
Sbjct:   58 KEEQQQQKQQQTHDGGPDLTPNRTEVTTKRTVDLFSFDGLAPERINGRSAMIGFVAAVGVELATGRDVFSQVFNGGVMWFLLTSAVLVLATLIPIYRGLSPEAKNNGFWNSDAEIWNGRFAMIGLVALAFTEYVKGGPLI 197          
BLAST of CB304783 vs. ExPASy Swiss-Prot
Match: ELI5_HORVU (High molecular mass early light-inducible protein HV58, chloroplastic OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 2.121e-28
Identity = 64/110 (58.18%), Postives = 78/110 (70.91%), Query Frame = -2
Query:  225 DVFAFSGPAPERINGRLAMIGFVAALAVELSKGQDVFAQLS--DGGVAWFLGTXXXXXXXXXVPLFKGVSVEFKSDGFMTSDAELWNGRFAMMGLVALAVTEFVKGSTLV 548
            D  AFSGPAPERINGRLAM+GFVAAL+VE ++G  +  Q+     G+AWFL T         +PL +G SVE KS G  ++DAELWNGRFAM+GLVALA TEF+ G+  V
Sbjct:  120 DALAFSGPAPERINGRLAMVGFVAALSVEAARGGGLLDQVGMWSSGLAWFLATAGVFSVASLLPLLQGQSVESKSSGIWSADAELWNGRFAMLGLVALAATEFITGAPFV 229          
BLAST of CB304783 vs. ExPASy Swiss-Prot
Match: ELI6_HORVU (Low molecular mass early light-inducible protein HV60, chloroplastic OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 3.063e-27
Identity = 63/117 (53.85%), Postives = 77/117 (65.81%), Query Frame = -2
Query:  225 PRISTKFSDVFAFSGPAPERINGRLAMIGFVAALAVELSKGQDVFAQLSDG-GVAWFLGTXXXXXXXXXVPLFKGVSVEFKSDGFMTSDAELWNGRFAMMGLVALAVTEFVKGSTLV 572
            P+ ST   D  AFSGPAPERINGRLAM+GFV ALAVE  +G  + +QL  G G AWF  T         VPL +G S E ++   M ++AELWNGRFAM+GLVALA TE + G+  +
Sbjct:   49 PKASTSIWDAMAFSGPAPERINGRLAMVGFVTALAVEAGRGDGLLSQLGSGTGQAWFAYTVAMLSMASLVPLLQGESAEGRAGAIMNANAELWNGRFAMIGLVALAATEIITGTPFI 165          
BLAST of CB304783 vs. ExPASy Swiss-Prot
Match: ELI9_HORVU (Low molecular mass early light-inducible protein HV90, chloroplastic OS=Hordeum vulgare PE=2 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 4.001e-27
Identity = 63/117 (53.85%), Postives = 77/117 (65.81%), Query Frame = -2
Query:  225 PRISTKFSDVFAFSGPAPERINGRLAMIGFVAALAVELSKGQDVFAQLSDG-GVAWFLGTXXXXXXXXXVPLFKGVSVEFKSDGFMTSDAELWNGRFAMMGLVALAVTEFVKGSTLV 572
            P+ ST   D  AFSGPAPERINGRLAM+GFV ALAVE  +G  + +QL  G G AWF  T         VPL +G S E ++   M ++AELWNGRFAM+GLVALA TE + G+  +
Sbjct:   54 PKASTSIWDEMAFSGPAPERINGRLAMVGFVTALAVEAGRGDGLLSQLGSGTGQAWFAYTVAVLSMASLVPLLQGESAEGRAGAIMNANAELWNGRFAMLGLVALAATEIITGAPFI 170          
BLAST of CB304783 vs. ExPASy Swiss-Prot
Match: CBR_DUNBA (Carotene biosynthesis-related protein CBR, chloroplastic OS=Dunaliella bardawil GN=CBR PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.249e-12
Identity = 54/122 (44.26%), Postives = 67/122 (54.92%), Query Frame = -2
Query:  228 TTKAPRISTKFSDVFAFSGPAPERINGRLAMIGFVAALAVELSKGQDVFAQLSDGGVAWFLGTXXXXXXXXXVPLF---KGVSVEFKSDGFMTSDAELWNGRFAMMGLVALAVTEFVKGSTL 584
            T  AP ++    +V  FSG APE INGRLAM+GFVAAL  ELS G+ V  QL D      L T         +P F   KG ++     G  T DAE+ NGRFAM+G  A+ V E ++G  L
Sbjct:   61 TPAAPTVT----EVMGFSG-APEIINGRLAMLGFVAALGAELSTGESVLTQLGDQPTLIAL-TFVLFSAASLIPAFARRKGDAM-----GPFTPDAEMTNGRFAMIGFAAMLVYEGIQGIAL 171          
The following BLAST results are available for this feature:
BLAST of CB304783 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
ELI_PEA1.199e-3968.07Early light-induced protein, chloroplastic OS=Pisu... [more]
DS22_CRAPL1.420e-3252.86Desiccation stress protein DSP-22, chloroplastic O... [more]
ELI5_HORVU2.121e-2858.18High molecular mass early light-inducible protein ... [more]
ELI6_HORVU3.063e-2753.85Low molecular mass early light-inducible protein H... [more]
ELI9_HORVU4.001e-2753.85Low molecular mass early light-inducible protein H... [more]
CBR_DUNBA1.249e-1244.26Carotene biosynthesis-related protein CBR, chlorop... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0002_IIaR_G12 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0002_IIaR_G12 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304783 ID=CB304783|Name=CB304783|organism=Citrus sinensis|type=EST|length=630bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTCAAAACGGAAAAGGGTGATT
TATTTAGAGAATTGGCATGGGAAAACAGGGATTTACATACAACACCACCA
TAATTCATACACAATAATTAGCCACGGAAGAAACATGACGTGCGCTTCAA
GTATTAAGAATAGGGTCCTGTTATCATTTCAAGACTCTGCAGTCCGCATA
TCACTGGAAAATTGGACTTAACTAAACAAGGGTACTGCCTTTAACAAACT
CAGTGACAGCCAAAGCAACAAGACCCATCATAGCGAACCTCCCATTCCAC
AACTCAGCATCCGAAGTCATGAACCCATCCGATTTAAACTCCACGCTGAC
ACCTTTAAACAAAGGAACCAGGGACGCAACCGAAAGCAGAACACTGGTCC
CCAAGAACCAGGCAACTCCACCGTCTGATAACTGGGCAAACACATCCTGA
CCCTTGGATAGCTCCACCGCCAATGCAGCCACGAACCCAATCATCGCAAG
CCTCCCGTTTATCCTCTCCGGTGCCGGCCCGCTGAACGCAAACACGTCAG
AGAACTTCGTGCTTATACGCGGAGCTTTGGTGGTGAGTTGATTATCCTTC
TGCTGCTCATTCTTACCATGCAGCGCATGA
back to top