CB304786

Overview
NameCB304786
Unique NameCB304786
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length574
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2614 contig Csv1_Contig2614:121..695. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304786 vs. ExPASy Swiss-Prot
Match: MT3_CARPA (Metallothionein-like protein type 3 OS=Carica papaya PE=3 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 2.467e-22
Identity = 45/66 (68.18%), Postives = 54/66 (81.82%), Query Frame = -3
Query:  291 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCARVNCTCG 488
            MSDTCGNCDCAD++QCVKKGSSY AD +ET+ S ++  VVMD  AAE +G CKCGP+C+  NCTCG
Sbjct:    1 MSDTCGNCDCADKTQCVKKGSSYTADIIETEKSIMT--VVMDAPAAENDGKCKCGPSCSCTNCTCG 64          
BLAST of CB304786 vs. ExPASy Swiss-Prot
Match: MT3_MUSAC (Metallothionein-like protein type 3 OS=Musa acuminata PE=3 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 1.830e-17
Identity = 38/64 (59.38%), Postives = 47/64 (73.44%), Query Frame = -3
Query:  288 TCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCARVNCTCGS 479
            TCGNCDC D+SQCVKKG+SY  D VET+ S+V  V+V   +AAE +G CKCG  CA  +C CG+
Sbjct:    3 TCGNCDCVDKSQCVKKGNSYGIDIVETEKSYVDEVIVA-AEAAEHDGKCKCGAACACTDCKCGN 65          
BLAST of CB304786 vs. ExPASy Swiss-Prot
Match: MT3_ACTDE (Metallothionein-like protein type 3 OS=Actinidia deliciosa GN=pKIWI503 PE=2 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 2.390e-17
Identity = 43/65 (66.15%), Postives = 48/65 (73.85%), Query Frame = -3
Query:  294 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCARVNCTC 488
            MSD CGNCDCAD SQCVKKG+S   D VETD S++   VVM V AAE+ G CKCG +C  VNCTC
Sbjct:    1 MSDKCGNCDCADSSQCVKKGNS--IDIVETDKSYIED-VVMGVPAAESGGKCKCGTSCPCVNCTC 62          
BLAST of CB304786 vs. ExPASy Swiss-Prot
Match: MT3_PRUAV (Metallothionein-like protein 1 OS=Prunus avium GN=MT1 PE=3 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 3.816e-15
Identity = 37/65 (56.92%), Postives = 44/65 (67.69%), Query Frame = -3
Query:  294 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCARVNCTC 488
            MS  C NCDC+D SQC KKG S+    VET+   + T V+MD  AAE  GNCKCGP+CA V+C C
Sbjct:    1 MSSKCSNCDCSDSSQCTKKGYSFDLVIVETENRSMDT-VIMDAPAAENGGNCKCGPSCACVDCKC 64          
BLAST of CB304786 vs. ExPASy Swiss-Prot
Match: MT3_MALDO (Metallothionein-like protein type 3 OS=Malus domestica GN=MT2 PE=3 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 6.508e-15
Identity = 38/66 (57.58%), Postives = 45/66 (68.18%), Query Frame = -3
Query:  291 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCARVNCTCG 488
            MS  C NCDCAD +QCVKKG+SY    VET+   + TV V D  AAE +G CKCG  C+ V+CTCG
Sbjct:    1 MSGKCDNCDCADSTQCVKKGNSYDLVIVETENRSMDTVFV-DAPAAEHDGKCKCGTGCSCVSCTCG 65          
BLAST of CB304786 vs. ExPASy Swiss-Prot
Match: MT3A_ORYSJ (Metallothionein-like protein 3A OS=Oryza sativa subsp. japonica GN=MT3A PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 2.473e-14
Identity = 35/66 (53.03%), Postives = 42/66 (63.64%), Query Frame = -3
Query:  291 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCARVNCTCG 488
            MSD CGNCDCAD+SQCVKKG+SY    VE + S        +V A E  G CKCG +C+  +C CG
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVEAEKSHFE-----EVAAGEENGGCKCGTSCSCTDCKCG 61          
BLAST of CB304786 vs. ExPASy Swiss-Prot
Match: MT3A_ORYSI (Metallothionein-like protein 3A OS=Oryza sativa subsp. indica GN=MT3A PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 2.473e-14
Identity = 35/66 (53.03%), Postives = 42/66 (63.64%), Query Frame = -3
Query:  291 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCARVNCTCG 488
            MSD CGNCDCAD+SQCVKKG+SY    VE + S        +V A E  G CKCG +C+  +C CG
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVEAEKSHFE-----EVAAGEENGGCKCGTSCSCTDCKCG 61          
BLAST of CB304786 vs. ExPASy Swiss-Prot
Match: MT3B_ORYSJ (Metallothionein-like protein 3B OS=Oryza sativa subsp. japonica GN=MT3B PE=2 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 2.315e-12
Identity = 32/66 (48.48%), Postives = 40/66 (60.61%), Query Frame = -3
Query:  291 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCARVNCTCG 488
            MSD CGNCDCAD+SQCVKKG+SY    V+ + S     +  +V   E +G CKC   C+   C CG
Sbjct:    1 MSDKCGNCDCADKSQCVKKGTSYGVVIVDAEKSHFE--MAEEVGYEENDGKCKCTTGCSCAGCNCG 64          
BLAST of CB304786 vs. ExPASy Swiss-Prot
Match: MT3B_ORYSI (Metallothionein-like protein 3B OS=Oryza sativa subsp. indica GN=MT3B PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 8.796e-12
Identity = 31/66 (46.97%), Postives = 40/66 (60.61%), Query Frame = -3
Query:  291 MSDTCGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCARVNCTCG 488
            MSD CG+CDCAD+SQCVKKG+SY    V+ + S     +  +V   E +G CKC   C+   C CG
Sbjct:    1 MSDKCGHCDCADKSQCVKKGTSYGVVIVDAEKSHFE--MAEEVGYEENDGKCKCTTGCSCAGCNCG 64          
The following BLAST results are available for this feature:
BLAST of CB304786 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
MT3_CARPA2.467e-2268.18Metallothionein-like protein type 3 OS=Carica papa... [more]
MT3_MUSAC1.830e-1759.38Metallothionein-like protein type 3 OS=Musa acumin... [more]
MT3_ACTDE2.390e-1766.15Metallothionein-like protein type 3 OS=Actinidia d... [more]
MT3_PRUAV3.816e-1556.92Metallothionein-like protein 1 OS=Prunus avium GN=... [more]
MT3_MALDO6.508e-1557.58Metallothionein-like protein type 3 OS=Malus domes... [more]
MT3A_ORYSJ2.473e-1453.03Metallothionein-like protein 3A OS=Oryza sativa su... [more]
MT3A_ORYSI2.473e-1453.03Metallothionein-like protein 3A OS=Oryza sativa su... [more]
MT3B_ORYSJ2.315e-1248.48Metallothionein-like protein 3B OS=Oryza sativa su... [more]
MT3B_ORYSI8.796e-1246.97Metallothionein-like protein 3B OS=Oryza sativa su... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0002_IIaR_H03 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0002_IIaR_H03 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304786 ID=CB304786|Name=CB304786|organism=Citrus sinensis|type=EST|length=574bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTCGAAATTAAACCACACAAGG
CCACGGTCATGGCCATGGCCATATATTACATGATTATGAAGAAGGAAACA
CAAAACATTACGAGTGATGGGTGACACAACACGCACATCACTCCACACAC
TAGTAGTAGACCATCATAAAAACGAAGTAGAGAATTTTTCTTTTTTTTTA
ATCACCCTTACATTATTCTTAACCCCCACAATATTTAGGCACACTTGCAG
CTTCTTATTTTTTGCTGCATGTGTCTGCTTATTAGTGACTACCACAAGTG
CAGTTCACACGAGCGCAGGTGGGGCCGCACTTGCAGTTACCTTCAGTCTC
AGCAGCCTGAACGTCCATGACAACAACGGTGCTGACAAAGCTCAAGTCAG
TCTCGACGAAGTCAGCAGCATAGCTGCTTCCCTTCTTCACACACTGGCTC
CTGTCAGCGCAGTCGCAGTTGCCGCAGGTGTCCGACATGTTGATTGAGCT
TAGAACTTGGAATTTAAAACTGGAAATAGAGGGCTCTTTATTGTACGAAA
CTTGCTTTGCTTTGCCGTGATCCC
back to top