CB304787

Overview
NameCB304787
Unique NameCB304787
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length601
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB304787 vs. ExPASy Swiss-Prot
Match: RAB7_VIGAC (Ras-related protein Rab7 OS=Vigna aconitifolia PE=2 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 2.088e-30
Identity = 67/84 (79.76%), Postives = 67/84 (79.76%), Query Frame = -1
Query:  353 LGNKIDIDGGNSRVVSEKKAKDWCASKGNIPYFETSAKEDVNVDXXXXXXXXXXXANEREQDIYFQGIPEAP-SENEQRGGCAC 601
            LGNKIDIDGGNSRVVSEKKAKDWCASKGNIPYFETSAKED NVD           ANE EQDIYFQGIPEA   ENEQR GCAC
Sbjct:  123 LGNKIDIDGGNSRVVSEKKAKDWCASKGNIPYFETSAKEDFNVDAAFLCIAKAALANEHEQDIYFQGIPEAAVPENEQRSGCAC 206          
BLAST of CB304787 vs. ExPASy Swiss-Prot
Match: RAB7_SOYBN (Ras-related protein Rab7 OS=Glycine max PE=2 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 4.652e-30
Identity = 66/84 (78.57%), Postives = 67/84 (79.76%), Query Frame = -1
Query:  353 LGNKIDIDGGNSRVVSEKKAKDWCASKGNIPYFETSAKEDVNVDXXXXXXXXXXXANEREQDIYFQGIPEAP-SENEQRGGCAC 601
            LGNKIDIDGGNSRVVSEKKAKDWCA+KGNIPYFETSAKED NVD           ANE EQDIYFQGIPEA   ENEQR GCAC
Sbjct:  123 LGNKIDIDGGNSRVVSEKKAKDWCAAKGNIPYFETSAKEDYNVDAAFLCIAKAALANEHEQDIYFQGIPEAAVPENEQRSGCAC 206          
BLAST of CB304787 vs. ExPASy Swiss-Prot
Match: RAB7_ARATH (Ras-related protein Rab7 OS=Arabidopsis thaliana GN=RAB7 PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 1.549e-25
Identity = 58/83 (69.88%), Postives = 63/83 (75.90%), Query Frame = -1
Query:  353 LGNKIDIDGGNSRVVSEKKAKDWCASKGNIPYFETSAKEDVNVDXXXXXXXXXXXANEREQDIYFQGIPEAPSENEQRGGCAC 601
            LGNK+DIDGGNSRVVSEKKA++WCA KGNI YFETSAKED NVD           ANER+QDIYFQ  P+  S  EQRGGCAC
Sbjct:  123 LGNKVDIDGGNSRVVSEKKAREWCAEKGNIVYFETSAKEDYNVDDSFLCITKLALANERDQDIYFQ--PDTGSVPEQRGGCAC 203          
BLAST of CB304787 vs. ExPASy Swiss-Prot
Match: RAB7_PRUAR (Ras-related protein Rab7 OS=Prunus armeniaca PE=2 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 9.723e-20
Identity = 52/85 (61.18%), Postives = 56/85 (65.88%), Query Frame = -1
Query:  353 LGNKIDIDGGNSRVVSEKKAKDWCASKGNIPYFETSAKEDVNVDXXXXXXXXXXXANEREQDIYF-QGIPEAPSENEQR-GGCAC 601
            LGNKID+DGGNSRVVSEKKAK WCASKGNIPYFETSAKE  NVD            NE E++IY    I  A    +QR  GC C
Sbjct:  123 LGNKIDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVDDAFQCIAKNALNNEPEEEIYLPDTIDVAGGGRQQRSSGCEC 207          
BLAST of CB304787 vs. ExPASy Swiss-Prot
Match: RAB7_GOSHI (Ras-related protein Rab7 OS=Gossypium hirsutum GN=RAB7 PE=2 SV=1)

HSP 1 Score: 96.2857 bits (238), Expect = 1.270e-19
Identity = 51/85 (60.00%), Postives = 56/85 (65.88%), Query Frame = -1
Query:  353 LGNKIDIDGGNSRVVSEKKAKDWCASKGNIPYFETSAKEDVNVDXXXXXXXXXXXANEREQDIYF-QGIPEAPSENEQRG-GCAC 601
            LGNK+D+DGGNSRVVSEKKAK WCASKGNIPYFETSAKE  NVD            NE E++IY  + I  A     QR  GC C
Sbjct:  123 LGNKVDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGFNVDAAFECIARNALKNEPEEEIYLPETIDVASGGRPQRSTGCEC 207          
BLAST of CB304787 vs. ExPASy Swiss-Prot
Match: RAB7_CENCI (Ras-related protein Rab7 OS=Cenchrus ciliaris PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 2.395e-18
Identity = 44/83 (53.01%), Postives = 52/83 (62.65%), Query Frame = -1
Query:  353 LGNKIDIDGGNSRVVSEKKAKDWCASKGNIPYFETSAKEDVNVDXXXXXXXXXXXANEREQDIYFQGIPEAPSENEQRGGCAC 601
            LGNK+D+DGGNSRVVSEKKAK WCASKGNIPYFETSAKE  NV+            NE E+++Y     +    N  +    C
Sbjct:  123 LGNKVDVDGGNSRVVSEKKAKAWCASKGNIPYFETSAKEGTNVEDAFQCIVKNALKNEPEEELYVPDTVDVVGGNRAQRSSGC 205          
BLAST of CB304787 vs. ExPASy Swiss-Prot
Match: RAB7_PEA (Ras-related protein Rab7 OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 6.968e-18
Identity = 43/84 (51.19%), Postives = 56/84 (66.67%), Query Frame = -1
Query:  353 LGNKIDIDGGNSRVVSEKKAKDWCASKGNIPYFETSAKEDVNVDXXXXXXXXXXXANEREQDIYFQGIPEAPSENEQRG-GCAC 601
            +GNKIDIDGGNSRVVSEKKA+ WCA+KGNIPYFETSAKE +NV+            +  E+++Y     +  + ++ R  GC C
Sbjct:  123 IGNKIDIDGGNSRVVSEKKARAWCAAKGNIPYFETSAKEGINVEEAFQTIAKDALKSGEEEELYLPDTIDVGNSSQPRSTGCEC 206          
BLAST of CB304787 vs. ExPASy Swiss-Prot
Match: YPTC5_CHLRE (GTP-binding protein YPTC5 OS=Chlamydomonas reinhardtii GN=YPTC5 PE=3 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 7.704e-17
Identity = 45/86 (52.33%), Postives = 58/86 (67.44%), Query Frame = -1
Query:  359 LGNKIDIDGGNSRVVSEKKAKDWCASKGNIPYFETSAKEDVNVDXXXXXXXXXXXANEREQDIYFQGIPEAPSEN-----EQRGGC 601
            LGNKID +GG+SR VSEKKAK WCASKG+IPYFETSAKED+NV+            NE+E++++   +P+A   N      +R GC
Sbjct:  123 LGNKIDENGGSSRQVSEKKAKAWCASKGSIPYFETSAKEDINVEAAFTCITRNALRNEKEEELF---MPDAVDMNTTATQRKRAGC 205          
BLAST of CB304787 vs. ExPASy Swiss-Prot
Match: RAB7_MESCR (Ras-related protein Rab7A OS=Mesembryanthemum crystallinum PE=2 SV=1)

HSP 1 Score: 85.5001 bits (210), Expect = 2.242e-16
Identity = 41/83 (49.40%), Postives = 49/83 (59.04%), Query Frame = -1
Query:  353 LGNKIDIDGGNSRVVSEKKAKDWCASKGNIPYFETSAKEDVNVDXXXXXXXXXXXANEREQDIYFQGIPEAPSENEQRGGCAC 601
            LGNKID+DGG+ RVVSEKKAK WC SKGNIPYFETSAK+  NV+            NE E++ Y     +       +   AC
Sbjct:  123 LGNKIDVDGGSGRVVSEKKAKAWCMSKGNIPYFETSAKDGTNVEEAFQCIAKNAIQNEPEEETYLPDTIDMAGSTRPQSSSAC 205          
BLAST of CB304787 vs. ExPASy Swiss-Prot
Match: YPTV5_VOLCA (GTP-binding protein yptV5 OS=Volvox carteri GN=YPTV5 PE=3 SV=1)

HSP 1 Score: 79.7221 bits (195), Expect = 1.230e-14
Identity = 44/86 (51.16%), Postives = 56/86 (65.12%), Query Frame = -1
Query:  359 LGNKIDIDGGNSRVVSEKKAKDWCASKGNIPYFETSAKEDVNVDXXXXXXXXXXXANEREQDIYFQGIPEAPSEN-----EQRGGC 601
            LGNKID  G N R V+EKKAK WCASKG+IPYFETSAKED+NV+            NE+E++++   +P+A   N      +RGGC
Sbjct:  123 LGNKIDEVGVN-RQVTEKKAKAWCASKGSIPYFETSAKEDINVEAAFTCITRNALRNEKEEELF---VPDAVDMNTSATQRKRGGC 204          
The following BLAST results are available for this feature:
BLAST of CB304787 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
RAB7_VIGAC2.088e-3079.76Ras-related protein Rab7 OS=Vigna aconitifolia PE=... [more]
RAB7_SOYBN4.652e-3078.57Ras-related protein Rab7 OS=Glycine max PE=2 SV=1[more]
RAB7_ARATH1.549e-2569.88Ras-related protein Rab7 OS=Arabidopsis thaliana G... [more]
RAB7_PRUAR9.723e-2061.18Ras-related protein Rab7 OS=Prunus armeniaca PE=2 ... [more]
RAB7_GOSHI1.270e-1960.00Ras-related protein Rab7 OS=Gossypium hirsutum GN=... [more]
RAB7_CENCI2.395e-1853.01Ras-related protein Rab7 OS=Cenchrus ciliaris PE=2... [more]
RAB7_PEA6.968e-1851.19Ras-related protein Rab7 OS=Pisum sativum PE=2 SV=... [more]
YPTC5_CHLRE7.704e-1752.33GTP-binding protein YPTC5 OS=Chlamydomonas reinhar... [more]
RAB7_MESCR2.242e-1649.40Ras-related protein Rab7A OS=Mesembryanthemum crys... [more]
YPTV5_VOLCA1.230e-1451.16GTP-binding protein yptV5 OS=Volvox carteri GN=YPT... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0002_IIaR_H04 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0002_IIaR_H04 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304787 ID=CB304787|Name=CB304787|organism=Citrus sinensis|type=EST|length=601bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTCCNNNNNATAATCTATACCT
CCTTCGAAGTCGGTCGGAGATGATAATATAGCCACCAATGGCTCAAAGAT
GATTAAAACAAATACAAGCATTCGATTCAAAACCAAAAGCAGTACAACAC
AACCCCCGAGTTAAATCTCATCGAGGTACTCTACAACTACAGTTTTAAAT
TATGATCAAGCTTGCCTCAAGTTCTGAGCTTAAGGGGTACAATTTCTACA
AAAAAAAATGGCTATGAATCATGATTGCCAAAATAAAAAATGAAGAATTA
AGCAACAAAATCAACAGCAACTACTCCACTAACTAGTATTGCCTCCAGCT
TAGCATGCACAACCACCTCTTTGCTCATTCTCTGAAGGTGCCTCAGGGAT
ACCCTGGAAATATATGTCTTGTTCACGCTCATTGGCTAGAGCAGCTCTTG
CAATAGACAAGAATGCAGCATCAACATTGACATCCTCCTTTGCTGAGGTC
TCAAAGTAAGGTATGTTGCCTTTGGAAGCACACCAGTCCTTGGCTTTCTT
CTCAGACACCACTCGACTGTTCCCACCATCGATATCAATCTTGTTTCCAA
G
back to top