CB304811

Overview
NameCB304811
Unique NameCB304811
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length460
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2614 contig Csv1_Contig2614:255..713. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304811 vs. ExPASy Swiss-Prot
Match: MT3_CARPA (Metallothionein-like protein type 3 OS=Carica papaya PE=3 SV=1)

HSP 1 Score: 70.0922 bits (170), Expect = 5.121e-12
Identity = 30/49 (61.22%), Postives = 37/49 (75.51%), Query Frame = -1
Query:  311 KKGSSYAADFVETDLSFVSTVVVMDVQAAEAEGNCKCGPTCACVNCACG 457
            KKGSSY AD +ET+ S ++  VVMD  AAE +G CKCGP+C+C NC CG
Sbjct:   18 KKGSSYTADIIETEKSIMT--VVMDAPAAENDGKCKCGPSCSCTNCTCG 64          
The following BLAST results are available for this feature:
BLAST of CB304811 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
MT3_CARPA5.121e-1261.22Metallothionein-like protein type 3 OS=Carica papa... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0002_IVaR_C08 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0002_IVaR_C08 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304811 ID=CB304811|Name=CB304811|organism=Citrus sinensis|type=EST|length=460bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTAGACTAACAATAATACATTA
AAATTAAACCACACAAGGCCACGGTCATGGCCATGGCCATATATTACATG
ATTATGAAGAAGGAAACACAAAACATTACGAGTGATGGGTGACACAACAC
GCACATCACTCCACACACTAGTAGTAGACCATCATAAAAACGAAGTAAAG
AATTTTTCTTTTTTTTTTTAATCACCCTTACATTATTCTTAACCCCCACA
ATATTTAGGCACACTTGCAGCTTCTTATTTTTTGCTGCATGTGTTTGCTT
ATTAGTGACTACCACAAGCGCAGTTCACACAAGCGCAGGTGGGGCCGCAC
TTGCAGTTACCTTCAGCCTCAGCAGCCTGAACGTCCATGACAACAACGGT
GCTGACAAAGCTCAAGTCAGTCTCGACGAAGTCAGCAGCATAGCTGCTTC
CCTTCTTCCC
back to top