CB304825

Overview
NameCB304825
Unique NameCB304825
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length516
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7725 contig Csv1_Contig7725:761..1276. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB304825 vs. ExPASy Swiss-Prot
Match: PSBO_TOBAC (Oxygen-evolving enhancer protein 1, chloroplastic OS=Nicotiana tabacum GN=PSBO PE=2 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 9.442e-54
Identity = 101/108 (93.52%), Postives = 106/108 (98.15%), Query Frame = -2
Query:  189 ENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE 512
            E+F GEFLVPSYRGSSFLDPKGRGGSTGYDNA+ALPAGGRGDEE+L KEN+KNTSSSTGKITLSVT+SKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE
Sbjct:  225 ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKNTSSSTGKITLSVTQSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE 332          
BLAST of CB304825 vs. ExPASy Swiss-Prot
Match: PSBO_SOLLC (Oxygen-evolving enhancer protein 1, chloroplastic OS=Solanum lycopersicum GN=PSBO PE=2 SV=2)

HSP 1 Score: 205.682 bits (522), Expect = 1.044e-52
Identity = 99/108 (91.67%), Postives = 105/108 (97.22%), Query Frame = -2
Query:  189 ENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE 512
            E+F GEFLVPSYRGSSFLDPKGRGGSTGYDNA+ALPAGGRGDEE+L KEN+KNT+S TGKITLSVT+SKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE
Sbjct:  222 ESFSGEFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKNTASLTGKITLSVTQSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE 329          
BLAST of CB304825 vs. ExPASy Swiss-Prot
Match: PSBO_FRIAG (Oxygen-evolving enhancer protein 1, chloroplastic OS=Fritillaria agrestis GN=PSBO PE=2 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 5.728e-51
Identity = 96/108 (88.89%), Postives = 102/108 (94.44%), Query Frame = -2
Query:  189 ENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE 512
            E+F G +LVPSYRGSSFLDPKGRGGS GYDNA+ALPAGGRGDEE+L KENIK+ SSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLG+K PKDVKIQGIWYAQLE
Sbjct:  222 ESFSGSYLVPSYRGSSFLDPKGRGGSAGYDNAVALPAGGRGDEEELVKENIKDVSSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGSKAPKDVKIQGIWYAQLE 329          
BLAST of CB304825 vs. ExPASy Swiss-Prot
Match: PSBO2_ARATH (Oxygen-evolving enhancer protein 1-2, chloroplastic OS=Arabidopsis thaliana GN=PSBO2 PE=1 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 1.276e-50
Identity = 91/108 (84.26%), Postives = 104/108 (96.30%), Query Frame = -2
Query:  189 ENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE 512
            E+F G+FLVPSYRGSSFLDPKGRGGSTGYDNA+ALPAGGRGDEE+L+KEN+KNT++S G+ITL +TKSKPETGEVIGVFES+QPSDTDLGAKVPKDVKIQG+WY Q+E
Sbjct:  224 ESFSGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELSKENVKNTAASVGEITLKITKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQIE 331          
BLAST of CB304825 vs. ExPASy Swiss-Prot
Match: PSBO1_ARATH (Oxygen-evolving enhancer protein 1-1, chloroplastic OS=Arabidopsis thaliana GN=PSBO1 PE=1 SV=2)

HSP 1 Score: 197.593 bits (501), Expect = 2.843e-50
Identity = 92/108 (85.19%), Postives = 103/108 (95.37%), Query Frame = -2
Query:  189 ENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE 512
            ++F G+FLVPSYRGSSFLDPKGRGGSTGYDNA+ALPAGGRGDEE+L KEN+KNT++S G+ITL VTKSKPETGEVIGVFES+QPSDTDLGAKVPKDVKIQG+WY QLE
Sbjct:  225 DSFTGKFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELVKENVKNTAASVGEITLKVTKSKPETGEVIGVFESLQPSDTDLGAKVPKDVKIQGVWYGQLE 332          
BLAST of CB304825 vs. ExPASy Swiss-Prot
Match: PSBO_SPIOL (Oxygen-evolving enhancer protein 1, chloroplastic OS=Spinacia oleracea GN=PSBO PE=1 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 8.271e-50
Identity = 93/109 (85.32%), Postives = 102/109 (93.58%), Query Frame = -2
Query:  186 ENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLEQ 512
            E+F G+FLVPSYRGSSFLDPKGRGGSTGYDNA+ALPAGGRGDEE+L KEN KN +SS G ITLSVT SKPETGEVIGVF+S+QPSDTDLGAKVPKDVKI+G+WYAQLEQ
Sbjct:  223 ESFSGDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENNKNVASSKGTITLSVTSSKPETGEVIGVFQSLQPSDTDLGAKVPKDVKIEGVWYAQLEQ 331          
BLAST of CB304825 vs. ExPASy Swiss-Prot
Match: PSBO_SOLTU (Oxygen-evolving enhancer protein 1, chloroplastic OS=Solanum tuberosum GN=PSBO PE=2 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 1.411e-49
Identity = 93/108 (86.11%), Postives = 101/108 (93.52%), Query Frame = -2
Query:  189 ENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE 512
            E+F  +FLVPSYRGSSFLDPKGRGGSTGYDNA+ALPAGGRGDEE+L KEN+KNT+S TGKIT +VTKS P+TGEVIGVFESIQPSDTDLGAK PKDVKIQGIWYAQLE
Sbjct:  225 ESFSVDFLVPSYRGSSFLDPKGRGGSTGYDNAVALPAGGRGDEEELQKENVKNTASLTGKITFTVTKSNPQTGEVIGVFESIQPSDTDLGAKTPKDVKIQGIWYAQLE 332          
BLAST of CB304825 vs. ExPASy Swiss-Prot
Match: PSBO_PEA (Oxygen-evolving enhancer protein 1, chloroplastic OS=Pisum sativum GN=PSBO PE=2 SV=1)

HSP 1 Score: 193.356 bits (490), Expect = 5.361e-49
Identity = 92/108 (85.19%), Postives = 101/108 (93.52%), Query Frame = -2
Query:  189 ENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE 512
            ++F GEFLVPSYRGSSFLDPKGRG STGYDNA+ALPAGGRGDEE+L KEN K+ +SS GKITLSVT++KPETGEVIGVFESIQPSDTDLGAK PKDVKIQG+WYAQLE
Sbjct:  221 DSFSGEFLVPSYRGSSFLDPKGRGASTGYDNAVALPAGGRGDEEELGKENNKSAASSKGKITLSVTQTKPETGEVIGVFESIQPSDTDLGAKAPKDVKIQGVWYAQLE 328          
BLAST of CB304825 vs. ExPASy Swiss-Prot
Match: PSBO_WHEAT (Oxygen-evolving enhancer protein 1, chloroplastic OS=Triticum aestivum GN=PSBO PE=2 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 7.246e-46
Identity = 91/102 (89.22%), Postives = 95/102 (93.14%), Query Frame = -2
Query:  189 FLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLE 494
            FLVPSYRGSSFLDPKGRGGSTGYDNA ALP GGRGDEE+LAKEN+KN SSSTG ITLSVTKSKPETGEVIGVFES+QPSDTDL A  PKDVKIQG+WYAQLE
Sbjct:  224 FLVPSYRGSSFLDPKGRGGSTGYDNAGALPRGGRGDEEELAKENVKNASSSTGNITLSVTKSKPETGEVIGVFESVQPSDTDLEA--PKDVKIQGVWYAQLE 323          
BLAST of CB304825 vs. ExPASy Swiss-Prot
Match: PSBO_VOLCA (Oxygen-evolving enhancer protein 1, chloroplastic OS=Volvox carteri GN=PSBO PE=2 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 3.605e-37
Identity = 74/109 (67.89%), Postives = 85/109 (77.98%), Query Frame = -2
Query:  186 ENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESIQPSDTDLGAKVPKDVKIQGIWYAQLEQ 512
            +N  G+F+VPSYRGSSFLDPKGRGGSTGYDNA+ALPA  R D E+L KEN+K+T +  G    SV K    TGE+ GVFESIQPSDTDLGAK PKD+KI G+WY QL Q
Sbjct:  187 DNIKGDFVVPSYRGSSFLDPKGRGGSTGYDNAVALPA--RADAEELLKENVKSTKALKGSAVFSVAKVNTATGEIAGVFESIQPSDTDLGAKPPKDIKITGLWYGQLSQ 293          
The following BLAST results are available for this feature:
BLAST of CB304825 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 19
Match NameE-valueIdentityDescription
PSBO_TOBAC9.442e-5493.52Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_SOLLC1.044e-5291.67Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_FRIAG5.728e-5188.89Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO2_ARATH1.276e-5084.26Oxygen-evolving enhancer protein 1-2, chloroplasti... [more]
PSBO1_ARATH2.843e-5085.19Oxygen-evolving enhancer protein 1-1, chloroplasti... [more]
PSBO_SPIOL8.271e-5085.32Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_SOLTU1.411e-4986.11Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_PEA5.361e-4985.19Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_WHEAT7.246e-4689.22Oxygen-evolving enhancer protein 1, chloroplastic ... [more]
PSBO_VOLCA3.605e-3767.89Oxygen-evolving enhancer protein 1, chloroplastic ... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0002_IVaR_E12 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0002_IVaR_E12 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB304825 ID=CB304825|Name=CB304825|organism=Citrus sinensis|type=EST|length=516bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTGAAATTGCAAGCATTATTAT
AGCATGCCATGATAATATACAGACGTGATAACATTCTCAGTGCTACTAAA
TTGAATTACAGAAATGTTTAGCAACACCTTCAACATGTTTCAAAATCTGA
ATAGGAATAAGTACACTCATACAAGAAAAGCTCTATTGCTCAAGCTGTGC
ATACCAAATACCCTGGATCTTAACATCCTTTGGAACCTTGGCTCCCAAAT
CAGTATCAGATGGCTGAATGCTCTCAAACACTCCAATAACCTCTCCGGTC
TCAGGCTTGCTCTTGGTAACGCTGAGGGTGATCTTCCCTGTTGAAGATGA
AGTATTCTTGATATTCTCCTTGGCGAGATCTTCCTCGTCCCCTCTTCCAC
CGGCAGGCAATGCAATAGCATTGTCATAACCAGTTGAACCACCCCTTCCC
TTTGGGTCCAAGAAGGATGATCCACGGTAAGATGGTACCAGGAATTCTCC
TCCGAAATTCTCAGCC
back to top