CB305075

Overview
NameCB305075
Unique NameCB305075
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length635
Libraries
Library NameType
Flavedo Maturecdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig2641 contig Csv1_Contig2641:322..956. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB305075 vs. ExPASy Swiss-Prot
Match: MT3_CARPA (Metallothionein-like protein type 3 OS=Carica papaya PE=3 SV=1)

HSP 1 Score: 102.064 bits (253), Expect = 2.564e-21
Identity = 42/62 (67.74%), Postives = 51/62 (82.26%), Query Frame = -1
Query:  450 CGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 635
            CGNCDCAD++QCVKKGSSY AD +ET+ S ++  VVMD  AAE +G CKCGP+C+C NCTCG
Sbjct:    5 CGNCDCADKTQCVKKGSSYTADIIETEKSIMT--VVMDAPAAENDGKCKCGPSCSCTNCTCG 64          
BLAST of CB305075 vs. ExPASy Swiss-Prot
Match: MT3_MUSAC (Metallothionein-like protein type 3 OS=Musa acuminata PE=3 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 3.465e-18
Identity = 38/63 (60.32%), Postives = 47/63 (74.60%), Query Frame = -1
Query:  447 CGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCGS 635
            CGNCDC D+SQCVKKG+SY  D VET+ S+V  V+V   +AAE +G CKCG  CAC +C CG+
Sbjct:    4 CGNCDCVDKSQCVKKGNSYGIDIVETEKSYVDEVIVA-AEAAEHDGKCKCGAACACTDCKCGN 65          
BLAST of CB305075 vs. ExPASy Swiss-Prot
Match: MT3_ACTDE (Metallothionein-like protein type 3 OS=Actinidia deliciosa GN=pKIWI503 PE=2 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 5.003e-17
Identity = 41/61 (67.21%), Postives = 46/61 (75.41%), Query Frame = -1
Query:  453 CGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTC 635
            CGNCDCAD SQCVKKG+S   D VETD S++  VV M V AAE+ G CKCG +C CVNCTC
Sbjct:    5 CGNCDCADSSQCVKKGNSI--DIVETDKSYIEDVV-MGVPAAESGGKCKCGTSCPCVNCTC 62          
BLAST of CB305075 vs. ExPASy Swiss-Prot
Match: MT3_PRUAV (Metallothionein-like protein 1 OS=Prunus avium GN=MT1 PE=3 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.609e-15
Identity = 36/61 (59.02%), Postives = 43/61 (70.49%), Query Frame = -1
Query:  453 CGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTC 635
            C NCDC+D SQC KKG S+    VET+   + TV+ MD  AAE  GNCKCGP+CACV+C C
Sbjct:    5 CSNCDCSDSSQCTKKGYSFDLVIVETENRSMDTVI-MDAPAAENGGNCKCGPSCACVDCKC 64          
BLAST of CB305075 vs. ExPASy Swiss-Prot
Match: MT3_MALDO (Metallothionein-like protein type 3 OS=Malus domestica GN=MT2 PE=3 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 2.102e-15
Identity = 37/62 (59.68%), Postives = 44/62 (70.97%), Query Frame = -1
Query:  450 CGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 635
            C NCDCAD +QCVKKG+SY    VET+   + TV V D  AAE +G CKCG  C+CV+CTCG
Sbjct:    5 CDNCDCADSTQCVKKGNSYDLVIVETENRSMDTVFV-DAPAAEHDGKCKCGTGCSCVSCTCG 65          
BLAST of CB305075 vs. ExPASy Swiss-Prot
Match: MT3A_ORYSJ (Metallothionein-like protein 3A OS=Oryza sativa subsp. japonica GN=MT3A PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 5.177e-14
Identity = 33/62 (53.23%), Postives = 40/62 (64.52%), Query Frame = -1
Query:  450 CGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 635
            CGNCDCAD+SQCVKKG+SY    VE + S        +V A E  G CKCG +C+C +C CG
Sbjct:    5 CGNCDCADKSQCVKKGTSYGVVIVEAEKSHFE-----EVAAGEENGGCKCGTSCSCTDCKCG 61          
BLAST of CB305075 vs. ExPASy Swiss-Prot
Match: MT3A_ORYSI (Metallothionein-like protein 3A OS=Oryza sativa subsp. indica GN=MT3A PE=3 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 5.177e-14
Identity = 33/62 (53.23%), Postives = 40/62 (64.52%), Query Frame = -1
Query:  450 CGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 635
            CGNCDCAD+SQCVKKG+SY    VE + S        +V A E  G CKCG +C+C +C CG
Sbjct:    5 CGNCDCADKSQCVKKGTSYGVVIVEAEKSHFE-----EVAAGEENGGCKCGTSCSCTDCKCG 61          
BLAST of CB305075 vs. ExPASy Swiss-Prot
Match: MT3B_ORYSJ (Metallothionein-like protein 3B OS=Oryza sativa subsp. japonica GN=MT3B PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 4.846e-12
Identity = 30/62 (48.39%), Postives = 38/62 (61.29%), Query Frame = -1
Query:  450 CGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 635
            CGNCDCAD+SQCVKKG+SY    V+ + S     +  +V   E +G CKC   C+C  C CG
Sbjct:    5 CGNCDCADKSQCVKKGTSYGVVIVDAEKSHFE--MAEEVGYEENDGKCKCTTGCSCAGCNCG 64          
BLAST of CB305075 vs. ExPASy Swiss-Prot
Match: MT3B_ORYSI (Metallothionein-like protein 3B OS=Oryza sativa subsp. indica GN=MT3B PE=3 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.841e-11
Identity = 29/62 (46.77%), Postives = 38/62 (61.29%), Query Frame = -1
Query:  450 CGNCDCADRSQCVKKGSSYAADFVETDLSFVSTVVVMDVQAAETEGNCKCGPTCACVNCTCG 635
            CG+CDCAD+SQCVKKG+SY    V+ + S     +  +V   E +G CKC   C+C  C CG
Sbjct:    5 CGHCDCADKSQCVKKGTSYGVVIVDAEKSHFE--MAEEVGYEENDGKCKCTTGCSCAGCNCG 64          
The following BLAST results are available for this feature:
BLAST of CB305075 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 9
Match NameE-valueIdentityDescription
MT3_CARPA2.564e-2167.74Metallothionein-like protein type 3 OS=Carica papa... [more]
MT3_MUSAC3.465e-1860.32Metallothionein-like protein type 3 OS=Musa acumin... [more]
MT3_ACTDE5.003e-1767.21Metallothionein-like protein type 3 OS=Actinidia d... [more]
MT3_PRUAV1.609e-1559.02Metallothionein-like protein 1 OS=Prunus avium GN=... [more]
MT3_MALDO2.102e-1559.68Metallothionein-like protein type 3 OS=Malus domes... [more]
MT3A_ORYSJ5.177e-1453.23Metallothionein-like protein 3A OS=Oryza sativa su... [more]
MT3A_ORYSI5.177e-1453.23Metallothionein-like protein 3A OS=Oryza sativa su... [more]
MT3B_ORYSJ4.846e-1248.39Metallothionein-like protein 3B OS=Oryza sativa su... [more]
MT3B_ORYSI1.841e-1146.77Metallothionein-like protein 3B OS=Oryza sativa su... [more]
back to top
Properties
Property NameValue
Genbank descriptionFLAVEDO0003_IVaR_G02 Flavedo Mature Citrus sinensis cDNA clone FLAVEDO0003_IVaR_G02 3, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB305075 ID=CB305075|Name=CB305075|organism=Citrus sinensis|type=EST|length=635bp
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTCTACAAATTTGGTACTATAT
ATGTTGATGTTCAAGGGTATGAATCCTTATGTGCATACTACAGCATGTTA
ATAAATTTCTCCTCCCACCTTCGAGACTGGAAGAAAAATAGGGGATGAGA
AAGATAGGGAGAGTTGGCTGTAGACTAACAATAATACATTAAAATTAAAC
CACACAAGGCCACGGTCATGGCCATGGCCATATATTACATGATTATGAAG
AAGGAAACACAAAACATTACGAGTGATGGGTGACACAACACGCACATCAC
TCCACACACTAGTAGTAGACCATCATAAAAACGAAGTAGAGAATTTTTCT
TTTTTTTTAATCACCCTTACATTATTCTTAACCCCCACAATATTTAGGCA
CACTTGCAGCTTCTTATTTTTTGCTGCATGTGTTTGCTTATTAGTGACTA
CCACAAGTGCAGTTCACACAAGCGCAGGTGGGGCCGCACTTGCAGTTACC
TTCAGTCTCAGCAGCCTGAACGTCCATGACAACAACGGTGCTGACAAAGC
TCAAGTCAGTCTCGACGAAGTCAGCAGCATAGCTGCTTCCCTTCTTCACA
CACTGGCTCCTGTCAGCGCAGTCGCAGTTGCCGCA
back to top