CB322088

Overview
NameCB322088
Unique NameCB322088
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length223
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CB322088 vs. ExPASy Swiss-Prot
Match: PMP22_ARATH (Peroxisomal membrane protein PMP22 OS=Arabidopsis thaliana GN=PMP22 PE=1 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 2.793e-18
Identity = 45/73 (61.64%), Postives = 51/73 (69.86%), Query Frame = 3
Query:    3 LIQLQQHPLRTKAITAGVLSAISDIVAQKLTGIXXXXXXXXXXXVLFGCAYLGPFRHFLHLILDKIFKGKKDT 221
            L QLQQHPLRTKAITAGVLS +SD+V+QKL+GI           V+F   +LGP  HF H  LDK FKGKKDT
Sbjct:   15 LSQLQQHPLRTKAITAGVLSGVSDVVSQKLSGIQKIQLRRVLLKVIFAGGFLGPAGHFFHTYLDKFFKGKKDT 87          
The following BLAST results are available for this feature:
BLAST of CB322088 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 1
Match NameE-valueIdentityDescription
PMP22_ARATH2.793e-1861.64Peroxisomal membrane protein PMP22 OS=Arabidopsis ... [more]
back to top
Libraries
Library NameType
Mature leaf blade cDNA subtraction librarycdna_library
Properties
Property NameValue
Genbank descriptionEST0196 Mature leaf blade cDNA subtraction library Citrus sinensis cDNA clone 24LB011 similar to peroxisomal membrane protein PMP22 (acc# NP_192356), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB322088 ID=CB322088|Name=CB322088|organism=Citrus sinensis|type=EST|length=223bp
ACTTGATACAACTTCAGCAACACCCTTTGAGAACAAAGGCAATAACTGCG
GGAGTGTTGTCAGCAATCAGCGACATAGTTGCTCAGAAACTCACTGGCAT
TCAGAAACTTCAGCTGAGGAGGCTACTTCTTAAAGTGCTTTTTGGATGTG
CTTATCTTGGACCGTTCAGACATTTCCTGCATTTAATCCTGGATAAAATT
TTCAAGGGGAAAAAAGATACCAG
back to top