CB417293

Overview
NameCB417293
Unique NameCB417293
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length562
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10200 contig Csv1_Contig10200:812..1373. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CB417293 vs. ExPASy Swiss-Prot
Match: SUSY_SOYBN (Sucrose synthase OS=Glycine max GN=SS PE=1 SV=2)

HSP 1 Score: 322.013 bits (824), Expect = 1.236e-87
Identity = 157/184 (85.33%), Postives = 168/184 (91.30%), Query Frame = 2
Query:    2 PETPFSELALRFQEIGLERGWGDTAERALEMIQXXXXXXEAPDPCTLETFLGRIPMVFNVVILTPHGYFAQDDVLGYPDTGGQVVYILDQVRALEDEMLLRIKQQGLDITPQILIITRLLPDAVGTTCGQRLEKVYGTKYSDILRVPFRTEKGVVRKWISRFEVWPYLETYTEDVAVEIAKELQ 553
            PETP+SE   +FQEIGLERGWGD AER LE IQ      EAPDPCTLETFLGRIPMVFNVVIL+PHGYFAQD+VLGYPDTGGQVVYILDQVRALE+EML RIKQQGLDI P+ILIITRLLPDAVGTTCGQRLEKV+GT++S ILRVPFRTEKG+VRKWISRFEVWPYLETYTEDVA E+AKELQ
Sbjct:  220 PETPYSEFEHKFQEIGLERGWGDNAERVLESIQLLLDLLEAPDPCTLETFLGRIPMVFNVVILSPHGYFAQDNVLGYPDTGGQVVYILDQVRALENEMLHRIKQQGLDIVPRILIITRLLPDAVGTTCGQRLEKVFGTEHSHILRVPFRTEKGIVRKWISRFEVWPYLETYTEDVAHELAKELQ 403          
BLAST of CB417293 vs. ExPASy Swiss-Prot
Match: SUSY_MEDSA (Sucrose synthase OS=Medicago sativa PE=2 SV=1)

HSP 1 Score: 318.546 bits (815), Expect = 1.367e-86
Identity = 156/185 (84.32%), Postives = 166/185 (89.73%), Query Frame = 2
Query:    2 PETPFSELALRFQEIGLERGWGDTAERALEMIQXXXXXXEAPDPCTLETFLGRIPMVFNVVILTPHGYFAQDDVLGYPDTGGQVVYILDQVRALEDEMLLRIKQQGLDITPQILIITRLLPDAVGTTCGQRLEKVYGTKYSDILRVPFRTEKGVVRKWISRFEVWPYLETYTEDVAVEIAKELQA 556
            PETP+SE   RFQEIGLERGWGDTAER LE IQ      EAPDPCTLE+FL RIPMVFNVVIL+PHGYFAQDDVLGYPDTGGQVVYILDQVRALE EML RIK+QGLDI P+ILIITRLLPDAVGTTCGQRLEKVYGT++  ILRVPFR EKG+VRKWISRFEVWPYLETYTEDVA E+AKELQ+
Sbjct:  220 PETPYSEFEHRFQEIGLERGWGDTAERVLESIQLLLDLLEAPDPCTLESFLDRIPMVFNVVILSPHGYFAQDDVLGYPDTGGQVVYILDQVRALESEMLSRIKKQGLDIIPRILIITRLLPDAVGTTCGQRLEKVYGTEHCHILRVPFRDEKGIVRKWISRFEVWPYLETYTEDVAHELAKELQS 404          
BLAST of CB417293 vs. ExPASy Swiss-Prot
Match: SUSY_PHAAU (Sucrose synthase OS=Phaseolus aureus GN=SS1 PE=1 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 2.331e-86
Identity = 155/184 (84.24%), Postives = 166/184 (90.22%), Query Frame = 2
Query:    2 PETPFSELALRFQEIGLERGWGDTAERALEMIQXXXXXXEAPDPCTLETFLGRIPMVFNVVILTPHGYFAQDDVLGYPDTGGQVVYILDQVRALEDEMLLRIKQQGLDITPQILIITRLLPDAVGTTCGQRLEKVYGTKYSDILRVPFRTEKGVVRKWISRFEVWPYLETYTEDVAVEIAKELQ 553
            PETP+S    +FQEIGLERGWGD AER LE IQ      EAPDPCTLETFLGRIPMVFNVVIL+PHGYFAQD+VLGYPDTGGQVVYILDQVRALE+EML RIKQQGLDI P+ILIITRLLPDAVGTTCGQRLEKV+GT++S ILRVPFRTE G+VRKWISRFEVWPYLETYTEDVA E+AKELQ
Sbjct:  220 PETPYSAFEHKFQEIGLERGWGDNAERVLESIQLLLDLLEAPDPCTLETFLGRIPMVFNVVILSPHGYFAQDNVLGYPDTGGQVVYILDQVRALENEMLHRIKQQGLDIVPRILIITRLLPDAVGTTCGQRLEKVFGTEHSHILRVPFRTENGIVRKWISRFEVWPYLETYTEDVAHELAKELQ 403          
BLAST of CB417293 vs. ExPASy Swiss-Prot
Match: SUSY_VICFA (Sucrose synthase OS=Vicia faba GN=SUCS PE=2 SV=1)

HSP 1 Score: 317.005 bits (811), Expect = 3.977e-86
Identity = 155/184 (84.24%), Postives = 165/184 (89.67%), Query Frame = 2
Query:    2 PETPFSELALRFQEIGLERGWGDTAERALEMIQXXXXXXEAPDPCTLETFLGRIPMVFNVVILTPHGYFAQDDVLGYPDTGGQVVYILDQVRALEDEMLLRIKQQGLDITPQILIITRLLPDAVGTTCGQRLEKVYGTKYSDILRVPFRTEKGVVRKWISRFEVWPYLETYTEDVAVEIAKELQ 553
            PETP+SE   RFQEIGLERGWGD+AER LE IQ      EAPDPCTLETFL RIPMVFNVVIL+PHGYFAQDDVLGYPDTGGQVVYILDQVRALE EML RIK+QGLDI P+ILIITRLLPDAVGTTCGQRLEKVYGT++  ILRVPFR +KG+VRKWISRFEVWPYLETYTEDVA E+AKELQ
Sbjct:  220 PETPYSEFEHRFQEIGLERGWGDSAERVLESIQLLLDLLEAPDPCTLETFLDRIPMVFNVVILSPHGYFAQDDVLGYPDTGGQVVYILDQVRALESEMLNRIKKQGLDIVPRILIITRLLPDAVGTTCGQRLEKVYGTEHCHILRVPFRDQKGIVRKWISRFEVWPYLETYTEDVAHELAKELQ 403          
BLAST of CB417293 vs. ExPASy Swiss-Prot
Match: SUS1_ARATH (Sucrose synthase 1 OS=Arabidopsis thaliana GN=SUS1 PE=2 SV=3)

HSP 1 Score: 304.294 bits (778), Expect = 2.667e-82
Identity = 145/182 (79.67%), Postives = 163/182 (89.56%), Query Frame = 2
Query:    5 ETPFSELALRFQEIGLERGWGDTAERALEMIQXXXXXXEAPDPCTLETFLGRIPMVFNVVILTPHGYFAQDDVLGYPDTGGQVVYILDQVRALEDEMLLRIKQQGLDITPQILIITRLLPDAVGTTCGQRLEKVYGTKYSDILRVPFRTEKGVVRKWISRFEVWPYLETYTEDVAVEIAKEL 550
            ET + E   +F+EIGLERGWGD AER L+MI+      EAPDPCTLETFLGR+PMVFNVVIL+PHGYFAQD+VLGYPDTGGQVVYILDQVRALE EML RIKQQGL+I P+ILI+TRLLPDAVGTTCG+RLE+VY ++Y DILRVPFRTEKG+VRKWISRFEVWPYLETYTED AVE++KEL
Sbjct:  223 ETLYEEFEAKFEEIGLERGWGDNAERVLDMIRLLLDLLEAPDPCTLETFLGRVPMVFNVVILSPHGYFAQDNVLGYPDTGGQVVYILDQVRALEIEMLQRIKQQGLNIKPRILILTRLLPDAVGTTCGERLERVYDSEYCDILRVPFRTEKGIVRKWISRFEVWPYLETYTEDAAVELSKEL 404          
BLAST of CB417293 vs. ExPASy Swiss-Prot
Match: SUSY_SOLLC (Sucrose synthase OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 1.729e-81
Identity = 147/185 (79.46%), Postives = 162/185 (87.57%), Query Frame = 2
Query:    2 PETPFSELALRFQEIGLERGWGDTAERALEMIQXXXXXXEAPDPCTLETFLGRIPMVFNVVILTPHGYFAQDDVLGYPDTGGQVVYILDQVRALEDEMLLRIKQQGLDITPQILIITRLLPDAVGTTCGQRLEKVYGTKYSDILRVPFRTEKGVVRKWISRFEVWPYLETYTEDVAVEIAKELQA 556
            PETPF E   +FQEIGLE+GWGDTAER LEM+       EAPD CTLE FLGRIPMVFNVVIL+PHGYFAQ++VLGYPDTGGQVVYILDQV ALE EML RIK+QGLDI P+ILI+TRLLPDAVGTTCGQRLEKVYGT++S ILRVPF TEKG+VRKWISRFEVWPY+ET+ EDVA EI+ ELQA
Sbjct:  220 PETPFFEFEHKFQEIGLEKGWGDTAERVLEMVCMLLDLLEAPDSCTLEKFLGRIPMVFNVVILSPHGYFAQENVLGYPDTGGQVVYILDQVPALEREMLKRIKEQGLDIIPRILIVTRLLPDAVGTTCGQRLEKVYGTEHSHILRVPFGTEKGIVRKWISRFEVWPYMETFIEDVAKEISAELQA 404          
BLAST of CB417293 vs. ExPASy Swiss-Prot
Match: SUS1_SOLTU (Sucrose synthase OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 300.442 bits (768), Expect = 3.852e-81
Identity = 145/185 (78.38%), Postives = 162/185 (87.57%), Query Frame = 2
Query:    2 PETPFSELALRFQEIGLERGWGDTAERALEMIQXXXXXXEAPDPCTLETFLGRIPMVFNVVILTPHGYFAQDDVLGYPDTGGQVVYILDQVRALEDEMLLRIKQQGLDITPQILIITRLLPDAVGTTCGQRLEKVYGTKYSDILRVPFRTEKGVVRKWISRFEVWPYLETYTEDVAVEIAKELQA 556
            PETP+ E   +FQEIGLE+GWGDTAER LEM+       EAPD CTLE FLGRIPMVFNVVIL+PHGYFAQ++VLGYPDTGGQVVYILDQV ALE EML RIK+QGLDI P+ILI+TRLLPDAVGTTCGQR+EKVYG ++S ILRVPFRTEKG+VRKWISRFEVWPY+ET+ EDVA EI+ ELQA
Sbjct:  220 PETPYFEFEHKFQEIGLEKGWGDTAERVLEMVCMLLDLLEAPDSCTLEKFLGRIPMVFNVVILSPHGYFAQENVLGYPDTGGQVVYILDQVPALEREMLKRIKEQGLDIIPRILIVTRLLPDAVGTTCGQRIEKVYGAEHSHILRVPFRTEKGIVRKWISRFEVWPYMETFIEDVAKEISAELQA 404          
BLAST of CB417293 vs. ExPASy Swiss-Prot
Match: SUS2_SOLTU (Sucrose synthase OS=Solanum tuberosum PE=3 SV=1)

HSP 1 Score: 298.13 bits (762), Expect = 1.912e-80
Identity = 146/185 (78.92%), Postives = 160/185 (86.49%), Query Frame = 2
Query:    2 PETPFSELALRFQEIGLERGWGDTAERALEMIQXXXXXXEAPDPCTLETFLGRIPMVFNVVILTPHGYFAQDDVLGYPDTGGQVVYILDQVRALEDEMLLRIKQQGLDITPQILIITRLLPDAVGTTCGQRLEKVYGTKYSDILRVPFRTEKGVVRKWISRFEVWPYLETYTEDVAVEIAKELQA 556
            PET +S    +FQEIGLERGWGDTAER LEMI       EAPD CTLE FLGRIPMVFNVVIL+PHGYFAQ++VLGYPDTGGQVVYILDQV ALE EML RIK+QGLDI P+ILI+TRLLPDAVGTTCGQRLEKV+GT++S ILRVPFRTEKG+VRKWISRFEVWPY+ET+ EDV  EI  ELQA
Sbjct:  220 PETSYSAFEHKFQEIGLERGWGDTAERVLEMICMLLDLLEAPDSCTLEKFLGRIPMVFNVVILSPHGYFAQENVLGYPDTGGQVVYILDQVPALEREMLKRIKEQGLDIKPRILIVTRLLPDAVGTTCGQRLEKVFGTEHSHILRVPFRTEKGIVRKWISRFEVWPYMETFIEDVGKEITAELQA 404          
BLAST of CB417293 vs. ExPASy Swiss-Prot
Match: SUS2_TULGE (Sucrose synthase 2 OS=Tulipa gesneriana PE=2 SV=1)

HSP 1 Score: 296.59 bits (758), Expect = 5.562e-80
Identity = 142/185 (76.76%), Postives = 161/185 (87.03%), Query Frame = 2
Query:    5 ETPFSELALRFQEIGLERGWGDTAERALEMIQXXXXXXEAPDPCTLETFLGRIPMVFNVVILTPHGYFAQDDVLGYPDTGGQVVYILDQVRALEDEMLLRIKQQGLDITPQILIITRLLPDAVGTTCGQRLEKVYGTKYSDILRVPFRTEKGVVRKWISRFEVWPYLETYTEDVAVEIAKELQAS 559
            +TP+S+   RFQE+GLE+GWGD A+R  E +       EAPDPCTLE FLG IPMVFNVVIL+PHGYFAQ +VLGYPDTGGQVVYILDQVRA+E EMLLRIKQQGLDITP+ILI+TRLLPDAVGTTCGQRLEKV GT+++ ILRVPFRTE G++RKWISRFEVWPYLETY EDVA E+A ELQA+
Sbjct:  222 DTPYSDFGHRFQELGLEKGWGDNAKRVHENLHLLLDLLEAPDPCTLENFLGTIPMVFNVVILSPHGYFAQANVLGYPDTGGQVVYILDQVRAMESEMLLRIKQQGLDITPRILIVTRLLPDAVGTTCGQRLEKVLGTEHTHILRVPFRTEHGILRKWISRFEVWPYLETYAEDVANEVAGELQAT 406          
BLAST of CB417293 vs. ExPASy Swiss-Prot
Match: SUS1_MAIZE (Sucrose synthase 1 OS=Zea mays GN=SH-1 PE=2 SV=1)

HSP 1 Score: 294.664 bits (753), Expect = 2.113e-79
Identity = 139/184 (75.54%), Postives = 161/184 (87.50%), Query Frame = 2
Query:    5 ETPFSELALRFQEIGLERGWGDTAERALEMIQXXXXXXEAPDPCTLETFLGRIPMVFNVVILTPHGYFAQDDVLGYPDTGGQVVYILDQVRALEDEMLLRIKQQGLDITPQILIITRLLPDAVGTTCGQRLEKVYGTKYSDILRVPFRTEKGVVRKWISRFEVWPYLETYTEDVAVEIAKELQA 556
            +TP+SE   RFQE+GLE+GWGDTA+R L+ +       EAPDP  LE FLG IPM+FNVVIL+PHGYFAQ +VLGYPDTGGQVVYILDQVRALE+EMLLRIKQQGLDITP+ILI+TRLLPDA GTTCGQRLEKV GT+++DI+RVPFR E G++RKWISRF+VWPYLETYTEDV+ EI KE+QA
Sbjct:  218 DTPYSEFNHRFQELGLEKGWGDTAKRVLDTLHLLLDLLEAPDPANLEKFLGTIPMMFNVVILSPHGYFAQSNVLGYPDTGGQVVYILDQVRALENEMLLRIKQQGLDITPKILIVTRLLPDAAGTTCGQRLEKVIGTEHTDIIRVPFRNENGILRKWISRFDVWPYLETYTEDVSSEIMKEMQA 401          
The following BLAST results are available for this feature:
BLAST of CB417293 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 23
Match NameE-valueIdentityDescription
SUSY_SOYBN1.236e-8785.33Sucrose synthase OS=Glycine max GN=SS PE=1 SV=2[more]
SUSY_MEDSA1.367e-8684.32Sucrose synthase OS=Medicago sativa PE=2 SV=1[more]
SUSY_PHAAU2.331e-8684.24Sucrose synthase OS=Phaseolus aureus GN=SS1 PE=1 S... [more]
SUSY_VICFA3.977e-8684.24Sucrose synthase OS=Vicia faba GN=SUCS PE=2 SV=1[more]
SUS1_ARATH2.667e-8279.67Sucrose synthase 1 OS=Arabidopsis thaliana GN=SUS1... [more]
SUSY_SOLLC1.729e-8179.46Sucrose synthase OS=Solanum lycopersicum PE=2 SV=1[more]
SUS1_SOLTU3.852e-8178.38Sucrose synthase OS=Solanum tuberosum PE=2 SV=1[more]
SUS2_SOLTU1.912e-8078.92Sucrose synthase OS=Solanum tuberosum PE=3 SV=1[more]
SUS2_TULGE5.562e-8076.76Sucrose synthase 2 OS=Tulipa gesneriana PE=2 SV=1[more]
SUS1_MAIZE2.113e-7975.54Sucrose synthase 1 OS=Zea mays GN=SH-1 PE=2 SV=1[more]

Pages

back to top
Libraries
Library NameType
Mature peel (flavedo) cDNA subtraction librarycdna_library
Properties
Property NameValue
Genbank descriptionEST0366 Mature peel (flavedo) cDNA subtraction library Citrus sinensis cDNA clone 6P009 similar to sucrose synthase (acc# BAA89049), mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CB417293 ID=CB417293|Name=CB417293|organism=Citrus sinensis|type=EST|length=562bp
ACCAGAAACGCCATTCTCTGAGTTGGCACTAAGATTTCAGGAGATTGGTT
TGGAGAGAGGTTGGGGTGATACTGCTGAGCGCGCACTTGAGATGATTCAG
CTTCTTTTGGATCTTCTTGAGGCACCTGATCCGTGCACTCTTGAGACTTT
CCTTGGCAGAATCCCCATGGTCTTTAATGTTGTGATCCTTACTCCCCACG
GTTACTTTGCCCAAGACGATGTTTTGGGCTACCCTGATACTGGTGGTCAG
GTTGTTTACATCTTGGATCAAGTTCGTGCCTTGGAGGATGAGATGCTTCT
TCGTATCAAGCAGCAAGGACTTGATATCACCCCTCAAATCCTCATTATTA
CCCGTCTCCTCCCAGATGCAGTAGGCACAACATGTGGTCAGCGACTTGAG
AAAGTTTATGGAACTAAGTATTCAGATATACTTCGAGTTCCCTTTAGAAC
TGAGAAGGGAGTTGTCCGCAAGTGGATCTCACGATTTGAAGTCTGGCCTT
ATCTAGAGACCTACACCGAGGATGTTGCTGTTGAAATTGCCAAAGAGTTG
CAGGCAAGCCTG
back to top