CB610764
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CB610764 vs. ExPASy Swiss-Prot
Match: LTI6B_ORYSJ (Hydrophobic protein LTI6B OS=Oryza sativa subsp. japonica GN=LTI6B PE=2 SV=1) HSP 1 Score: 69.707 bits (169), Expect = 5.185e-12 Identity = 31/35 (88.57%), Postives = 32/35 (91.43%), Query Frame = 1 Query: 4 VFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 108 VFLKFGC EFWICLLLT LGYIPGIIYA+YAITK Sbjct: 21 VFLKFGCGHEFWICLLLTFLGYIPGIIYAIYAITK 55
BLAST of CB610764 vs. ExPASy Swiss-Prot
Match: LTI6B_ORYSI (Hydrophobic protein LTI6B OS=Oryza sativa subsp. indica GN=LTI6B PE=3 SV=2) HSP 1 Score: 69.707 bits (169), Expect = 5.185e-12 Identity = 31/35 (88.57%), Postives = 32/35 (91.43%), Query Frame = 1 Query: 4 VFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 108 VFLKFGC EFWICLLLT LGYIPGIIYA+YAITK Sbjct: 21 VFLKFGCGHEFWICLLLTFLGYIPGIIYAIYAITK 55
BLAST of CB610764 vs. ExPASy Swiss-Prot
Match: RCI2B_ARATH (Hydrophobic protein RCI2B OS=Arabidopsis thaliana GN=RCI2B PE=2 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 2.573e-11 Identity = 27/35 (77.14%), Postives = 32/35 (91.43%), Query Frame = 1 Query: 4 VFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 108 VFLKFGCK EFWICL+LT+ GY+PGI+YA+Y ITK Sbjct: 20 VFLKFGCKVEFWICLILTLFGYLPGILYALYIITK 54
BLAST of CB610764 vs. ExPASy Swiss-Prot
Match: RCI2A_ARATH (Hydrophobic protein RCI2A OS=Arabidopsis thaliana GN=RCI2A PE=2 SV=1) HSP 1 Score: 66.6254 bits (161), Expect = 4.390e-11 Identity = 27/35 (77.14%), Postives = 32/35 (91.43%), Query Frame = 1 Query: 4 VFLKFGCKAEFWICLLLTILGYIPGIIYAVYAITK 108 VFL+FGC EFWICL+LT+LGYIPGIIYA+Y +TK Sbjct: 20 VFLRFGCGVEFWICLVLTLLGYIPGIIYAIYVLTK 54 The following BLAST results are available for this feature:
BLAST of CB610764 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 4
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CB610764 ID=CB610764; Name=CB610764; organism=Citrus sinensis; type=EST; length=389bpback to top |