CF417199

Overview
NameCF417199
Unique NameCF417199
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length697
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF417199 vs. ExPASy Swiss-Prot
Match: CKB11_ARATH (Cyclin-dependent kinase B1-1 OS=Arabidopsis thaliana GN=CDKB1-1 PE=1 SV=2)

HSP 1 Score: 290.812 bits (743), Expect = 5.389e-91
Identity = 149/198 (75.25%), Postives = 158/198 (79.80%), Query Frame = 3
Query:    6 MEKYEKLEKVGEGTYGKVYKAKDKATGQLVALKKTRLEMDEEGIPPTALREVSLLQMLSQSLYVVRLLCVEHVDSSLKSNNPSPDSASAFATSNNGKSNLYLVFEYLDTDLKKFIDSHRKGPNPRPLPPTLIQSFLYQLCKGVAHCHSHGVLHRDLKPQNXXXXXXXXXXXXXXXGLGRAFTVPLKSYTHEIVTLWYR 599
            MEKYEKLEKVGEGTYGKVYKA +K TG+LVALKKTRLEMDEEGIPPTALRE+SLLQMLS S+YVVRLLCVEHV      + PS  S S        KSNLYLVFEYLDTDLKKFIDS+RKGPNP+PL P LIQ  ++QLCKGVAHCHSHGVLHRDLKPQN               GLGRAFTVPLKSYTHEIVTLWYR
Sbjct:    1 MEKYEKLEKVGEGTYGKVYKAMEKGTGKLVALKKTRLEMDEEGIPPTALREISLLQMLSTSIYVVRLLCVEHV------HQPSTKSQST-------KSNLYLVFEYLDTDLKKFIDSYRKGPNPKPLEPFLIQKLMFQLCKGVAHCHSHGVLHRDLKPQNLLLVKDKELLKIADLGLGRAFTVPLKSYTHEIVTLWYR 185          

HSP 2 Score: 64.6994 bits (156), Expect = 5.389e-91
Identity = 29/31 (93.55%), Postives = 30/31 (96.77%), Query Frame = 1
Query:  601 APEVLLGSTHYSTAVDMWSVGCIFAEMVKRQ 693
            APEVLLGSTHYST VDMWSVGCIFAEMV+RQ
Sbjct:  186 APEVLLGSTHYSTGVDMWSVGCIFAEMVRRQ 216          
BLAST of CF417199 vs. ExPASy Swiss-Prot
Match: CKB12_ARATH (Cyclin-dependent kinase B1-2 OS=Arabidopsis thaliana GN=CDKB1-2 PE=1 SV=2)

HSP 1 Score: 285.804 bits (730), Expect = 2.227e-89
Identity = 145/198 (73.23%), Postives = 157/198 (79.29%), Query Frame = 3
Query:    6 MEKYEKLEKVGEGTYGKVYKAKDKATGQLVALKKTRLEMDEEGIPPTALREVSLLQMLSQSLYVVRLLCVEHVDSSLKSNNPSPDSASAFATSNNGKSNLYLVFEYLDTDLKKFIDSHRKGPNPRPLPPTLIQSFLYQLCKGVAHCHSHGVLHRDLKPQNXXXXXXXXXXXXXXXGLGRAFTVPLKSYTHEIVTLWYR 599
            MEKYEKLEKVGEGTYGKVYKA +K TG+LVALKKTRLEMDEEGIPPTALRE+SLLQMLSQS+Y+VRLLCVEHV  S  S             S++ KSNLYLVFEYLDTDLKKFIDSHRKG NPRPL  +L+Q F++QL KGVAHCHSHGVLHRDLKPQN               GL RAFTVPLK+YTHEIVTLWYR
Sbjct:    1 MEKYEKLEKVGEGTYGKVYKAMEKTTGKLVALKKTRLEMDEEGIPPTALREISLLQMLSQSIYIVRLLCVEHVIQSKDST-----------VSHSPKSNLYLVFEYLDTDLKKFIDSHRKGSNPRPLEASLVQRFMFQLFKGVAHCHSHGVLHRDLKPQNLLLDKDKGILKIADLGLSRAFTVPLKAYTHEIVTLWYR 187          

HSP 2 Score: 64.3142 bits (155), Expect = 2.227e-89
Identity = 28/31 (90.32%), Postives = 31/31 (100.00%), Query Frame = 1
Query:  601 APEVLLGSTHYSTAVDMWSVGCIFAEMVKRQ 693
            APEVLLGSTHYSTAVD+WSVGCIFAEM++RQ
Sbjct:  188 APEVLLGSTHYSTAVDIWSVGCIFAEMIRRQ 218          
BLAST of CF417199 vs. ExPASy Swiss-Prot
Match: CDC2C_ANTMA (Cell division control protein 2 homolog C OS=Antirrhinum majus GN=CDC2C PE=2 SV=1)

HSP 1 Score: 287.345 bits (734), Expect = 2.436e-88
Identity = 148/198 (74.75%), Postives = 156/198 (78.79%), Query Frame = 3
Query:    6 MEKYEKLEKVGEGTYGKVYKAKDKATGQLVALKKTRLEMDEEGIPPTALREVSLLQMLSQSLYVVRLLCVEHVDSSLKSNNPSPDSASAFATSNNGKSNLYLVFEYLDTDLKKFIDSHRKGPNPRPLPPTLIQSFLYQLCKGVAHCHSHGVLHRDLKPQNXXXXXXXXXXXXXXXGLGRAFTVPLKSYTHEIVTLWYR 599
            MEKYEKLEKVGEGTYGKVYKA +K+TGQ+VALKKTRLEMDEEG+PPTALREVSLLQMLSQSLYVVRLL VEHVD +                  NGK  LYLVFEYLDTDLKKFIDSHRKGPNPRPLPP  IQSFL+QLCKGV+HCH+HGVLHRDLKPQN               GL RAFTVPLKSYTHEIVTL YR
Sbjct:    1 MEKYEKLEKVGEGTYGKVYKALEKSTGQVVALKKTRLEMDEEGVPPTALREVSLLQMLSQSLYVVRLLSVEHVDCA-----------------KNGKPLLYLVFEYLDTDLKKFIDSHRKGPNPRPLPPQQIQSFLFQLCKGVSHCHAHGVLHRDLKPQNLLLDKDKGVLKIADLGLARAFTVPLKSYTHEIVTLSYR 181          

HSP 2 Score: 59.3066 bits (142), Expect = 2.436e-88
Identity = 28/31 (90.32%), Postives = 30/31 (96.77%), Query Frame = 1
Query:  601 APEVLLGSTHYSTAVDMWSVGCIFAEMVKRQ 693
            APEVLLGS+HYSTAVDM SVGCIFAEMV+RQ
Sbjct:  182 APEVLLGSSHYSTAVDMSSVGCIFAEMVRRQ 212          
BLAST of CF417199 vs. ExPASy Swiss-Prot
Match: CKB11_ORYSJ (Cyclin-dependent kinase B1-1 OS=Oryza sativa subsp. japonica GN=CDKB1-1 PE=2 SV=1)

HSP 1 Score: 281.182 bits (718), Expect = 1.201e-87
Identity = 141/198 (71.21%), Postives = 155/198 (78.28%), Query Frame = 3
Query:    6 MEKYEKLEKVGEGTYGKVYKAKDKATGQLVALKKTRLEMDEEGIPPTALREVSLLQMLSQSLYVVRLLCVEHVDSSLKSNNPSPDSASAFATSNNGKSNLYLVFEYLDTDLKKFIDSHRKGPNPRPLPPTLIQSFLYQLCKGVAHCHSHGVLHRDLKPQNXXXXXXXXXXXXXXXGLGRAFTVPLKSYTHEIVTLWYR 599
            MEKYEKLEKVGEGTYGKVYKA+D+ATGQLVALKKTRLEMDEEGIPPTALRE+S+L++LSQSLYVVRLL VE                     + NGK  LYLVFE+LDTDLKKF+D++RKGPNPRPLP  +I+SFLYQLCKGVAHCH HGVLHRDLKPQN               GLGRAFTVP+KSYTHEIVTLWYR
Sbjct:    1 MEKYEKLEKVGEGTYGKVYKAQDRATGQLVALKKTRLEMDEEGIPPTALREISILRLLSQSLYVVRLLSVEQA-------------------TKNGKPVLYLVFEFLDTDLKKFVDAYRKGPNPRPLPTNVIKSFLYQLCKGVAHCHGHGVLHRDLKPQNLLVDKEKGILKIADLGLGRAFTVPMKSYTHEIVTLWYR 179          

HSP 2 Score: 63.1586 bits (152), Expect = 1.201e-87
Identity = 28/31 (90.32%), Postives = 30/31 (96.77%), Query Frame = 1
Query:  601 APEVLLGSTHYSTAVDMWSVGCIFAEMVKRQ 693
            APEVLLGSTHYST VD+WSVGCIFAEMV+RQ
Sbjct:  180 APEVLLGSTHYSTGVDIWSVGCIFAEMVRRQ 210          
BLAST of CF417199 vs. ExPASy Swiss-Prot
Match: CKB21_ORYSJ (Cyclin-dependent kinase B2-1 OS=Oryza sativa subsp. japonica GN=CDKB2-1 PE=1 SV=1)

HSP 1 Score: 216.853 bits (551), Expect = 1.298e-65
Identity = 113/198 (57.07%), Postives = 137/198 (69.19%), Query Frame = 3
Query:    6 MEKYEKLEKVGEGTYGKVYKAKDKATGQLVALKKTRLEMDEEGIPPTALREVSLLQMLSQSLYVVRLLCVEHVDSSLKSNNPSPDSASAFATSNNGKSNLYLVFEYLDTDLKKFIDSHRKGPNPRPLPPTLIQSFLYQLCKGVAHCHSHGVLHRDLKPQNXXXXXXXXXXXXXXXGLGRAFTVPLKSYTHEIVTLWYR 599
            M+ YEKLEKVGEGTYGKVYKA++KATG++VALKKTRL  D+EG+PPTALREVSLL+MLSQ  +VVRLL ++                     +  G++ LYLVFEY+DTDLKKFI +HR+  N + +P   ++  +YQLCKGVA CH  GVLHRDLKP N               GL R+FTVPLK YTHEI+TLWYR
Sbjct:   25 MDLYEKLEKVGEGTYGKVYKAREKATGRIVALKKTRLPEDDEGVPPTALREVSLLRMLSQDSHVVRLLDLKQ------------------GQNKEGQTILYLVFEYMDTDLKKFIRAHRQ--NLQKIPVPTVKILMYQLCKGVAFCHGRGVLHRDLKPHNLLMDRKTMALKIADLGLSRSFTVPLKKYTHEILTLWYR 202          

HSP 2 Score: 53.9138 bits (128), Expect = 1.298e-65
Identity = 23/31 (74.19%), Postives = 26/31 (83.87%), Query Frame = 1
Query:  601 APEVLLGSTHYSTAVDMWSVGCIFAEMVKRQ 693
            APEVLLG+ HYST VD+WSVGCIFAE+   Q
Sbjct:  203 APEVLLGAAHYSTPVDIWSVGCIFAELATNQ 233          
BLAST of CF417199 vs. ExPASy Swiss-Prot
Match: CKB22_ARATH (Cyclin-dependent kinase B2-2 OS=Arabidopsis thaliana GN=CDKB2-2 PE=1 SV=2)

HSP 1 Score: 210.305 bits (534), Expect = 1.693e-65
Identity = 108/199 (54.27%), Postives = 135/199 (67.84%), Query Frame = 3
Query:    6 MEKYEKLEKVGEGTYGKVYKAKDKATGQLVALKKTRLEMDEEGIPPTALREVSLLQMLSQSLYVVRLLCVEHVDSSLKSNNPSPDSASAFATSNNGKSNLYLVFEYLDTDLKKFIDSHRK-GPNPRPLPPTLIQSFLYQLCKGVAHCHSHGVLHRDLKPQNXXXXXXXXXXXXXXXGLGRAFTVPLKSYTHEIVTLWYR 599
            ME +EKLEKVGEGTYGKVY+A++KATG +VALKKTRL  DEEG+PPT LRE+S+L+ML++  ++VRL+ V+                     +  GK+ LYLVFEY+DTDLKKFI S R+ G N   +P   ++  +YQLCKG+A CH HGVLHRDLKP N               GL RAFT+P+K YTHEI+TLWYR
Sbjct:   13 MEAFEKLEKVGEGTYGKVYRAREKATGMIVALKKTRLHEDEEGVPPTTLREISILRMLARDPHIVRLMDVKQ------------------GINKEGKTVLYLVFEYVDTDLKKFIRSFRQAGQN---IPQNTVKCLMYQLCKGMAFCHGHGVLHRDLKPHNLLMDRKTMTLKIADLGLARAFTLPMKKYTHEILTLWYR 190          

HSP 2 Score: 60.077 bits (144), Expect = 1.693e-65
Identity = 26/31 (83.87%), Postives = 29/31 (93.55%), Query Frame = 1
Query:  601 APEVLLGSTHYSTAVDMWSVGCIFAEMVKRQ 693
            APEVLLG+THYST VDMWSVGCIFAE+V +Q
Sbjct:  191 APEVLLGATHYSTGVDMWSVGCIFAELVTKQ 221          
BLAST of CF417199 vs. ExPASy Swiss-Prot
Match: CKB21_ARATH (Cyclin-dependent kinase B2-1 OS=Arabidopsis thaliana GN=CDKB2-1 PE=1 SV=2)

HSP 1 Score: 208.379 bits (529), Expect = 3.755e-65
Identity = 106/198 (53.54%), Postives = 134/198 (67.68%), Query Frame = 3
Query:    6 MEKYEKLEKVGEGTYGKVYKAKDKATGQLVALKKTRLEMDEEGIPPTALREVSLLQMLSQSLYVVRLLCVEHVDSSLKSNNPSPDSASAFATSNNGKSNLYLVFEYLDTDLKKFIDSHRKGPNPRPLPPTLIQSFLYQLCKGVAHCHSHGVLHRDLKPQNXXXXXXXXXXXXXXXGLGRAFTVPLKSYTHEIVTLWYR 599
            M+ +EKLEKVGEGTYGKVY+A++KATG++VALKKTRL  DEEG+P T LRE+S+L+ML++  +VVRL+ V+                     S  GK+ LYLVFEY+DTD+KKFI S R     + +P   I+S +YQLCKG+A CH HG+LHRDLKP N               GL RAFT+P+K YTHEI+TLWYR
Sbjct:   11 MDAFEKLEKVGEGTYGKVYRAREKATGKIVALKKTRLHEDEEGVPSTTLREISILRMLARDPHVVRLMDVKQ------------------GLSKEGKTVLYLVFEYMDTDVKKFIRSFRS--TGKNIPTQTIKSLMYQLCKGMAFCHGHGILHRDLKPHNLLMDPKTMRLKIADLGLARAFTLPMKKYTHEILTLWYR 188          

HSP 2 Score: 60.8474 bits (146), Expect = 3.755e-65
Identity = 27/31 (87.10%), Postives = 29/31 (93.55%), Query Frame = 1
Query:  601 APEVLLGSTHYSTAVDMWSVGCIFAEMVKRQ 693
            APEVLLG+THYSTAVDMWSVGCIFAE+V  Q
Sbjct:  189 APEVLLGATHYSTAVDMWSVGCIFAELVTNQ 219          
BLAST of CF417199 vs. ExPASy Swiss-Prot
Match: CDC2D_ANTMA (Cell division control protein 2 homolog D OS=Antirrhinum majus GN=CDC2D PE=2 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 7.583e-63
Identity = 107/198 (54.04%), Postives = 133/198 (67.17%), Query Frame = 3
Query:    6 MEKYEKLEKVGEGTYGKVYKAKDKATGQLVALKKTRLEMDEEGIPPTALREVSLLQMLSQSLYVVRLLCVEHVDSSLKSNNPSPDSASAFATSNNGKSNLYLVFEYLDTDLKKFIDSHRKGPNPRPLPPTLIQSFLYQLCKGVAHCHSHGVLHRDLKPQNXXXXXXXXXXXXXXXGLGRAFTVPLKSYTHEIVTLWYR 599
            M+ + KLEKVGEGTYGKVY+A +K+TG++VALKKTRL  DEEG+PPT LREVSLL+MLS+  +VVRLL V+                     +  GK+ LYLVFEY+DTDLKK+I S ++      + P  ++S +YQLCKGVA CH HGVLHRDLKP N               GL RA+T+P+K YTHEI+TLWYR
Sbjct:   11 MDAFVKLEKVGEGTYGKVYRAMEKSTGKIVALKKTRLHEDEEGVPPTTLREVSLLRMLSRDPHVVRLLDVKQ------------------GQNKEGKTVLYLVFEYMDTDLKKYIRSFKQ--TGESIAPMNVKSLMYQLCKGVAFCHGHGVLHRDLKPHNLLMDRKTMMLKIADLGLARAYTLPIKKYTHEILTLWYR 188          

HSP 2 Score: 55.0694 bits (131), Expect = 7.583e-63
Identity = 24/31 (77.42%), Postives = 28/31 (90.32%), Query Frame = 1
Query:  601 APEVLLGSTHYSTAVDMWSVGCIFAEMVKRQ 693
            APEVLLG+THYS AVDMWSV CIFAE+V ++
Sbjct:  189 APEVLLGATHYSPAVDMWSVACIFAELVTQK 219          
BLAST of CF417199 vs. ExPASy Swiss-Prot
Match: CDC2_MAIZE (Cell division control protein 2 homolog OS=Zea mays GN=CDC2 PE=2 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 8.803e-55
Identity = 98/198 (49.49%), Postives = 126/198 (63.64%), Query Frame = 3
Query:    6 MEKYEKLEKVGEGTYGKVYKAKDKATGQLVALKKTRLEMDEEGIPPTALREVSLLQMLSQSLYVVRLLCVEHVDSSLKSNNPSPDSASAFATSNNGKSNLYLVFEYLDTDLKKFIDSHRKGPNPRPLPPTLIQSFLYQLCKGVAHCHSHGVLHRDLKPQNXXXXXXXXXXXXXXXGLGRAFTVPLKSYTHEIVTLWYR 599
            ME+YEK+EK+GEGTYG VYKA DKAT + +ALKK RLE ++EG+P TA+RE+SLL+ ++    +VRL  V H                        +  +YLVFEYLD DLKKF+DS  +        PTLI+S+LYQ+  GVA+CHSH VLHRDLKPQN               GL RAF +P++++THE+VTLWYR
Sbjct:    1 MEQYEKVEKIGEGTYGVVYKALDKATNETIALKKIRLEQEDEGVPSTAIREISLLKEMNHG-NIVRLHDVVH-----------------------SEKRIYLVFEYLDLDLKKFMDSCPEFAKN----PTLIKSYLYQILHGVAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTHEVVTLWYR 170          

HSP 2 Score: 51.9878 bits (123), Expect = 8.803e-55
Identity = 22/31 (70.97%), Postives = 27/31 (87.10%), Query Frame = 1
Query:  601 APEVLLGSTHYSTAVDMWSVGCIFAEMVKRQ 693
            APE+LLG+  YST VD+WSVGCIFAEMV ++
Sbjct:  171 APEILLGARQYSTPVDVWSVGCIFAEMVNQK 201          
BLAST of CF417199 vs. ExPASy Swiss-Prot
Match: CDKA1_ORYSJ (Cyclin-dependent kinase A-1 OS=Oryza sativa subsp. japonica GN=CDKA-1 PE=1 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 8.803e-55
Identity = 96/198 (48.48%), Postives = 125/198 (63.13%), Query Frame = 3
Query:    6 MEKYEKLEKVGEGTYGKVYKAKDKATGQLVALKKTRLEMDEEGIPPTALREVSLLQMLSQSLYVVRLLCVEHVDSSLKSNNPSPDSASAFATSNNGKSNLYLVFEYLDTDLKKFIDSHRKGPNPRPLPPTLIQSFLYQLCKGVAHCHSHGVLHRDLKPQNXXXXXXXXXXXXXXXGLGRAFTVPLKSYTHEIVTLWYR 599
            ME+YEK EK+GEGTYG VY+A+DK T + +ALKK RLE ++EG+P TA+RE+SLL+ +     +VRL  V H                        +  +YLVFEYLD DLKKF+DS  +        PTLI+S+LYQ+ +GVA+CHSH VLHRDLKPQN               GL RAF +P++++THE+VTLWYR
Sbjct:    1 MEQYEKEEKIGEGTYGVVYRARDKVTNETIALKKIRLEQEDEGVPSTAIREISLLKEMHHG-NIVRLHDVIH-----------------------SEKRIYLVFEYLDLDLKKFMDSCPEFAKN----PTLIKSYLYQILRGVAYCHSHRVLHRDLKPQNLLIDRRTNALKLADFGLARAFGIPVRTFTHEVVTLWYR 170          

HSP 2 Score: 54.6842 bits (130), Expect = 8.803e-55
Identity = 24/31 (77.42%), Postives = 27/31 (87.10%), Query Frame = 1
Query:  601 APEVLLGSTHYSTAVDMWSVGCIFAEMVKRQ 693
            APE+LLGS  YST VDMWSVGCIFAEMV ++
Sbjct:  171 APEILLGSRQYSTPVDMWSVGCIFAEMVNQK 201          
The following BLAST results are available for this feature:
BLAST of CF417199 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 480
Match NameE-valueIdentityDescription
CKB11_ARATH5.389e-9175.25Cyclin-dependent kinase B1-1 OS=Arabidopsis thalia... [more]
CKB12_ARATH2.227e-8973.23Cyclin-dependent kinase B1-2 OS=Arabidopsis thalia... [more]
CDC2C_ANTMA2.436e-8874.75Cell division control protein 2 homolog C OS=Antir... [more]
CKB11_ORYSJ1.201e-8771.21Cyclin-dependent kinase B1-1 OS=Oryza sativa subsp... [more]
CKB21_ORYSJ1.298e-6557.07Cyclin-dependent kinase B2-1 OS=Oryza sativa subsp... [more]
CKB22_ARATH1.693e-6554.27Cyclin-dependent kinase B2-2 OS=Arabidopsis thalia... [more]
CKB21_ARATH3.755e-6553.54Cyclin-dependent kinase B2-1 OS=Arabidopsis thalia... [more]
CDC2D_ANTMA7.583e-6354.04Cell division control protein 2 homolog D OS=Antir... [more]
CDC2_MAIZE8.803e-5549.49Cell division control protein 2 homolog OS=Zea may... [more]
CDKA1_ORYSJ8.803e-5548.48Cyclin-dependent kinase A-1 OS=Oryza sativa subsp.... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_115000-129 Citrus sinensis: Insect-damaged immature leaves/stems from field collected Valencia orange Citrus sinensis cDNA clone IDFL-002_E10 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF417199 ID=CF417199|Name=CF417199|organism=Citrus sinensis|type=EST|length=697bp
AGAGGATGGAGAAGTACGAGAAGCTAGAGAAGGTGGGAGAAGGAACGTAC
GGGAAAGTGTACAAGGCAAAGGACAAAGCGACCGGGCAGTTGGTTGCTCT
GAAGAAAACAAGACTCGAAATGGATGAAGAAGGCATCCCCCCGACCGCTC
TCCGCGAAGTGTCCCTCCTCCAGATGCTCTCTCAATCCCTTTACGTCGTC
CGCCTCCTCTGCGTCGAACACGTGGACTCCTCTCTCAAATCCAACAACCC
CAGCCCCGACTCCGCTTCCGCCTTCGCCACCTCCAACAACGGCAAGTCTA
ATCTCTATCTCGTGTTTGAATACCTCGACACCGATCTAAAGAAATTCATC
GACTCGCACCGCAAGGGCCCCAATCCGAGGCCGCTGCCCCCCACTCTCAT
TCAGAGCTTCTTGTACCAGCTTTGCAAAGGCGTCGCCCACTGCCACAGCC
ACGGTGTCCTTCATCGCGACCTGAAGCCGCAGAATCTTCTCCTTGATAAG
GACAAGGGGATTCTCAAGATCGCCGATCTTGGCCTCGGACGCGCCTTCAC
CGTTCCTCTCAAAAGCTATACCCACGAGATTGTTACTCTCTGGTATAGGG
GCTCCCGAGGTGCTTCTTGGTTCCACTCATTACTCCACTGCTGTCGACAT
GTGGTCCGTTGGTTGCATTTTCGCTGAGATGGTTAAAAGGCAGGTTT
back to top