CF417350
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF417350 vs. ExPASy Swiss-Prot
Match: RL12_PRUAR (60S ribosomal protein L12 OS=Prunus armeniaca GN=RPL12 PE=2 SV=1) HSP 1 Score: 73.559 bits (179), Expect = 3.562e-13 Identity = 35/40 (87.50%), Postives = 35/40 (87.50%), Query Frame = 1 Query: 52 MPPKFDPSQVVDVYVRVTGGEVGPXXSLAPKIGPLGTLPK 171 MPPKFDPSQVVDVYVRVTGGEVG SLAPKIGPLG PK Sbjct: 1 MPPKFDPSQVVDVYVRVTGGEVGAASSLAPKIGPLGLSPK 40
BLAST of CF417350 vs. ExPASy Swiss-Prot
Match: RL123_ARATH (60S ribosomal protein L12-3 OS=Arabidopsis thaliana GN=RPL12C PE=2 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 1.768e-12 Identity = 33/40 (82.50%), Postives = 34/40 (85.00%), Query Frame = 1 Query: 52 MPPKFDPSQVVDVYVRVTGGEVGPXXSLAPKIGPLGTLPK 171 MPPK DPSQ+VDVYVRVTGGEVG SLAPKIGPLG PK Sbjct: 1 MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPK 40
BLAST of CF417350 vs. ExPASy Swiss-Prot
Match: RL122_ARATH (60S ribosomal protein L12-2 OS=Arabidopsis thaliana GN=RPL12B PE=2 SV=1) HSP 1 Score: 71.2478 bits (173), Expect = 1.768e-12 Identity = 33/40 (82.50%), Postives = 34/40 (85.00%), Query Frame = 1 Query: 52 MPPKFDPSQVVDVYVRVTGGEVGPXXSLAPKIGPLGTLPK 171 MPPK DPSQ+VDVYVRVTGGEVG SLAPKIGPLG PK Sbjct: 1 MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPK 40
BLAST of CF417350 vs. ExPASy Swiss-Prot
Match: RL121_ARATH (60S ribosomal protein L12-1 OS=Arabidopsis thaliana GN=RPL12A PE=1 SV=2) HSP 1 Score: 71.2478 bits (173), Expect = 1.768e-12 Identity = 33/40 (82.50%), Postives = 34/40 (85.00%), Query Frame = 1 Query: 52 MPPKFDPSQVVDVYVRVTGGEVGPXXSLAPKIGPLGTLPK 171 MPPK DPSQ+VDVYVRVTGGEVG SLAPKIGPLG PK Sbjct: 1 MPPKLDPSQIVDVYVRVTGGEVGAASSLAPKIGPLGLAPK 40 The following BLAST results are available for this feature:
BLAST of CF417350 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 4
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CF417350 ID=CF417350; Name=CF417350; organism=Citrus sinensis; type=EST; length=175bpback to top |