CF503803

Overview
NameCF503803
Unique NameCF503803
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length295
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig642 contig Csv1_Contig642:147..441. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF503803 vs. ExPASy Swiss-Prot
Match: ADHX_ARATH (Alcohol dehydrogenase class-3 OS=Arabidopsis thaliana GN=ADH2 PE=1 SV=2)

HSP 1 Score: 164.081 bits (414), Expect = 2.043e-40
Identity = 77/81 (95.06%), Postives = 81/81 (100.00%), Query Frame = 2
Query:   53 MSTEGQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEG 295
            M+T+GQVITCKAAVA+EPNKPLVIEDVQVAPPQAGEVRIKIL+TALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEG
Sbjct:    1 MATQGQVITCKAAVAYEPNKPLVIEDVQVAPPQAGEVRIKILYTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEG 81          
BLAST of CF503803 vs. ExPASy Swiss-Prot
Match: ADHX_ORYSI (Alcohol dehydrogenase class-3 OS=Oryza sativa subsp. indica GN=ADHIII PE=3 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 1.729e-39
Identity = 75/82 (91.46%), Postives = 78/82 (95.12%), Query Frame = 2
Query:   50 AMSTEGQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEG 295
            A ST+GQVITCKAAVAWE NKP+ IEDVQVAPPQAGEVR+KILFTALCHTD YTWSGKDPEGLFPCILGHEAAGIVESVGEG
Sbjct:    2 ASSTQGQVITCKAAVAWEANKPMTIEDVQVAPPQAGEVRVKILFTALCHTDHYTWSGKDPEGLFPCILGHEAAGIVESVGEG 83          
BLAST of CF503803 vs. ExPASy Swiss-Prot
Match: ADHX_MAIZE (Alcohol dehydrogenase class-3 OS=Zea mays GN=FDH PE=2 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 1.729e-39
Identity = 76/82 (92.68%), Postives = 79/82 (96.34%), Query Frame = 2
Query:   50 AMSTEGQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEG 295
            A  T+GQVITCKAAVA+EPNKPLVIEDVQVAPPQAGEVR+KILFTALCHTD YTWSGKDPEGLFPCILGHEAAGIVESVGEG
Sbjct:    2 ASPTQGQVITCKAAVAYEPNKPLVIEDVQVAPPQAGEVRVKILFTALCHTDHYTWSGKDPEGLFPCILGHEAAGIVESVGEG 83          
BLAST of CF503803 vs. ExPASy Swiss-Prot
Match: ADHX_ORYSJ (Alcohol dehydrogenase class-3 OS=Oryza sativa subsp. japonica GN=Os02g0815500 PE=2 SV=1)

HSP 1 Score: 159.844 bits (403), Expect = 3.852e-39
Identity = 74/82 (90.24%), Postives = 78/82 (95.12%), Query Frame = 2
Query:   50 AMSTEGQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEG 295
            A ST+GQVITCKAAVAWE N+P+ IEDVQVAPPQAGEVR+KILFTALCHTD YTWSGKDPEGLFPCILGHEAAGIVESVGEG
Sbjct:    2 ASSTQGQVITCKAAVAWEANRPMTIEDVQVAPPQAGEVRVKILFTALCHTDHYTWSGKDPEGLFPCILGHEAAGIVESVGEG 83          
BLAST of CF503803 vs. ExPASy Swiss-Prot
Match: ADHX_PEA (Alcohol dehydrogenase class-3 OS=Pisum sativum PE=1 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 2.761e-37
Identity = 72/80 (90.00%), Postives = 76/80 (95.00%), Query Frame = 2
Query:   56 STEGQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEG 295
            +T+GQVITCKAAVAWEPNKPL IEDV+VAPPQA EVRI+ILFTALCHTDAYT  GKDPEGLFPCILGHEAAGIVESVGEG
Sbjct:    1 ATQGQVITCKAAVAWEPNKPLTIEDVEVAPPQANEVRIQILFTALCHTDAYTLGGKDPEGLFPCILGHEAAGIVESVGEG 80          
BLAST of CF503803 vs. ExPASy Swiss-Prot
Match: ADHX_DICDI (Alcohol dehydrogenase class-3 OS=Dictyostelium discoideum GN=adh5 PE=3 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 6.365e-34
Identity = 64/81 (79.01%), Postives = 72/81 (88.89%), Query Frame = 2
Query:   53 MSTEGQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEG 295
            MSTEG+VITCKAAVAWE  KPLVIED++V PPQ GEVRIKIL+T +CHTD+YT SG DPEG+FPCILGHE  GIVES+GEG
Sbjct:    1 MSTEGKVITCKAAVAWEAKKPLVIEDIEVQPPQKGEVRIKILYTGVCHTDSYTLSGSDPEGIFPCILGHEGGGIVESIGEG 81          
BLAST of CF503803 vs. ExPASy Swiss-Prot
Match: ADHX_DROME (Alcohol dehydrogenase class-3 OS=Drosophila melanogaster GN=Fdh PE=1 SV=3)

HSP 1 Score: 132.494 bits (332), Expect = 6.586e-31
Identity = 62/80 (77.50%), Postives = 70/80 (87.50%), Query Frame = 2
Query:   56 STEGQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEG 295
            +TEG+VITCKAAVAWE  KPLVIED++VAPP+A EVRIKI  T +CHTDA+T SG DPEGLFP +LGHE AGIVESVGEG
Sbjct:    3 ATEGKVITCKAAVAWEAKKPLVIEDIEVAPPKAHEVRIKITATGVCHTDAFTLSGADPEGLFPVVLGHEGAGIVESVGEG 82          
BLAST of CF503803 vs. ExPASy Swiss-Prot
Match: ADHX_SPAAU (Alcohol dehydrogenase class-3 OS=Sparus aurata PE=2 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 9.511e-30
Identity = 61/81 (75.31%), Postives = 66/81 (81.48%), Query Frame = 2
Query:   53 MSTEGQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEG 295
            M T G+VI CKAAVAWEP KPL IE+V+VAPP A EVRIK+  T +CHTDAYT SG DPEGLFP ILGHE AG VESVGEG
Sbjct:    1 METAGKVIKCKAAVAWEPGKPLSIEEVEVAPPNAHEVRIKLFATGVCHTDAYTLSGSDPEGLFPVILGHEGAGTVESVGEG 81          
BLAST of CF503803 vs. ExPASy Swiss-Prot
Match: ADHH_GADMO (Alcohol dehydrogenase class-3 chain H OS=Gadus morhua PE=1 SV=1)

HSP 1 Score: 128.257 bits (321), Expect = 1.242e-29
Identity = 59/80 (73.75%), Postives = 68/80 (85.00%), Query Frame = 2
Query:   56 STEGQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEG 295
            +T GQVI CKAAVAWE  KPL +E+V+VAPP+AGEVRIK++ T +CHTDAYT SG DPEG FP ILGHE AG+VESVGEG
Sbjct:    1 ATAGQVIKCKAAVAWEAGKPLSLEEVEVAPPRAGEVRIKVVATGVCHTDAYTLSGSDPEGAFPVILGHEGAGLVESVGEG 80          
BLAST of CF503803 vs. ExPASy Swiss-Prot
Match: ADHX_CAEEL (Alcohol dehydrogenase class-3 OS=Caenorhabditis elegans GN=H24K24.3 PE=2 SV=1)

HSP 1 Score: 126.716 bits (317), Expect = 3.614e-29
Identity = 59/80 (73.75%), Postives = 66/80 (82.50%), Query Frame = 2
Query:   56 STEGQVITCKAAVAWEPNKPLVIEDVQVAPPQAGEVRIKILFTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEG 295
            ST GQVI CKAAVAW    PL IE +QVAPP+A EVR+KIL+TA+CHTDAYT  G DPEGLFP +LGHE +GIVESVGEG
Sbjct:    3 STAGQVINCKAAVAWSAKAPLSIETIQVAPPKAHEVRVKILYTAVCHTDAYTLDGHDPEGLFPVVLGHEGSGIVESVGEG 82          
The following BLAST results are available for this feature:
BLAST of CF503803 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 109
Match NameE-valueIdentityDescription
ADHX_ARATH2.043e-4095.06Alcohol dehydrogenase class-3 OS=Arabidopsis thali... [more]
ADHX_ORYSI1.729e-3991.46Alcohol dehydrogenase class-3 OS=Oryza sativa subs... [more]
ADHX_MAIZE1.729e-3992.68Alcohol dehydrogenase class-3 OS=Zea mays GN=FDH P... [more]
ADHX_ORYSJ3.852e-3990.24Alcohol dehydrogenase class-3 OS=Oryza sativa subs... [more]
ADHX_PEA2.761e-3790.00Alcohol dehydrogenase class-3 OS=Pisum sativum PE=... [more]
ADHX_DICDI6.365e-3479.01Alcohol dehydrogenase class-3 OS=Dictyostelium dis... [more]
ADHX_DROME6.586e-3177.50Alcohol dehydrogenase class-3 OS=Drosophila melano... [more]
ADHX_SPAAU9.511e-3075.31Alcohol dehydrogenase class-3 OS=Sparus aurata PE=... [more]
ADHH_GADMO1.242e-2973.75Alcohol dehydrogenase class-3 chain H OS=Gadus mor... [more]
ADHX_CAEEL3.614e-2973.75Alcohol dehydrogenase class-3 OS=Caenorhabditis el... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-289 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-10_A02 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF503803 ID=CF503803|Name=CF503803|organism=Citrus sinensis|type=EST|length=295bp
CTCGTTTCTTTTTGTGGTCTGTTTTTCATTCTCATTTTCATTGTCAGCAG
CCATGTCTACTGAAGGTCAAGTCATCACATGCAAAGCGGCGGTGGCCTGG
GAACCCAACAAGCCATTGGTGATTGAGGATGTGCAGGTTGCTCCGCCTCA
GGCTGGCGAGGTCCGAATCAAGATTCTCTTCACTGCTCTCTGCCACACTG
ATGCTTACACCTGGAGCGGCAAGGATCCTGAAGGTCTCTTCCCTTGTATC
CTAGGTCATGAGGCTGCTGGGATTGTGGAGAGTGTTGGTGAAGGT
back to top