CF503805

Overview
NameCF503805
Unique NameCF503805
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length407
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9403 contig Csv1_Contig9403:61..465. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF503805 vs. ExPASy Swiss-Prot
Match: TRNH_DATST (Tropinone reductase homolog OS=Datura stramonium PE=2 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 1.696e-38
Identity = 59/95 (62.11%), Postives = 75/95 (78.95%), Query Frame = 2
Query:  122 VHTCSRNEADLSECIRDWKTKGFKVTGSVCDVSSRIEREKLINQVSSLFDGKLNILINNVGTTIRKATVEYTAEDFSFLMATNFESAYNLCQLAH 406
            V+TCSR++ DL EC+  W+ KGFKV+G VCDVSS  +R+ L+  V+S F+GKLNILINN GTTI K    +TAED+S +M TNFE++YNLCQLAH
Sbjct:   44 VYTCSRSQNDLDECLEKWRRKGFKVSGPVCDVSSISQRQTLMESVTSSFNGKLNILINNAGTTIPKEATNFTAEDYSIIMGTNFEASYNLCQLAH 138          

HSP 2 Score: 50.0618 bits (118), Expect = 1.696e-38
Identity = 20/29 (68.97%), Postives = 29/29 (100.00%), Query Frame = 3
Query:   18 NQRWTVQGMTALVTGGTKGLGHAVVEELA 104
            ++RW+++GMTALVTGGT+G+G+A+VEELA
Sbjct:   10 DRRWSLRGMTALVTGGTRGIGYAIVEELA 38          
BLAST of CF503805 vs. ExPASy Swiss-Prot
Match: TRNH1_ARATH (Tropinone reductase homolog At1g07440 OS=Arabidopsis thaliana GN=At1g07440 PE=1 SV=1)

HSP 1 Score: 130.568 bits (327), Expect = 1.081e-37
Identity = 61/95 (64.21%), Postives = 77/95 (81.05%), Query Frame = 2
Query:  122 VHTCSRNEADLSECIRDWKTKGFKVTGSVCDVSSRIEREKLINQVSSLFDGKLNILINNVGTTIRKATVEYTAEDFSFLMATNFESAYNLCQLAH 406
            +HTC+RNE +L+EC+  W+ KGF+VTGSVCD S R EREKL+  VSS+F GKL+ILINN+G    K T++YTAEDFSF ++TN ESAY+L QLAH
Sbjct:   41 IHTCARNEYELNECLSKWQKKGFQVTGSVCDASLRPEREKLMQTVSSMFGGKLDILINNLGAIRSKPTLDYTAEDFSFHISTNLESAYHLSQLAH 135          

HSP 2 Score: 47.3654 bits (111), Expect = 1.081e-37
Identity = 19/29 (65.52%), Postives = 25/29 (86.21%), Query Frame = 3
Query:   18 NQRWTVQGMTALVTGGTKGLGHAVVEELA 104
            +QRW+++  T LVTGGTKG+GHA+VEE A
Sbjct:    7 SQRWSLKAKTVLVTGGTKGIGHAIVEEFA 35          
BLAST of CF503805 vs. ExPASy Swiss-Prot
Match: TRN2_DATST (Tropinone reductase 2 OS=Datura stramonium GN=TR2 PE=1 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 1.128e-33
Identity = 54/100 (54.00%), Postives = 77/100 (77.00%), Query Frame = 2
Query:  107 ALVPAVHTCSRNEADLSECIRDWKTKGFKVTGSVCDVSSRIEREKLINQVSSLFDGKLNILINNVGTTIRKATVEYTAEDFSFLMATNFESAYNLCQLAH 406
            +L  +V+TCSRN+ +L++C+  W++KGFKV  SVCD+SSR ER++L+N V++ F GKLNIL+NN G  I K   +YT ED+S +M+ NFE+AY+L  LAH
Sbjct:   31 SLGASVYTCSRNQKELNDCLTQWRSKGFKVEASVCDLSSRSERQELMNTVANHFHGKLNILVNNAGIVIYKEAKDYTVEDYSLIMSINFEAAYHLSVLAH 130          

HSP 2 Score: 43.8986 bits (102), Expect = 1.128e-33
Identity = 17/27 (62.96%), Postives = 24/27 (88.89%), Query Frame = 3
Query:   24 RWTVQGMTALVTGGTKGLGHAVVEELA 104
            RW ++G TALVTGG++G+G+ +VEELA
Sbjct:    4 RWNLEGCTALVTGGSRGIGYGIVEELA 30          
BLAST of CF503805 vs. ExPASy Swiss-Prot
Match: TRN1_DATST (Tropinone reductase 1 OS=Datura stramonium GN=TR1 PE=1 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 1.912e-33
Identity = 51/95 (53.68%), Postives = 71/95 (74.74%), Query Frame = 2
Query:  122 VHTCSRNEADLSECIRDWKTKGFKVTGSVCDVSSRIEREKLINQVSSLFDGKLNILINNVGTTIRKATVEYTAEDFSFLMATNFESAYNLCQLAH 406
            V+TCSRNE +L EC+  W+ KG  V GSVCD+ SR ER+KL+  V+ +FDGKLNIL+NN G  I K   ++T +D++ +M TNFE+AY+L Q+A+
Sbjct:   48 VYTCSRNEKELDECLEIWREKGLNVEGSVCDLLSRTERDKLMQTVAHVFDGKLNILVNNAGVVIHKEAKDFTEKDYNIIMGTNFEAAYHLSQIAY 142          

HSP 2 Score: 46.595 bits (109), Expect = 1.912e-33
Identity = 19/27 (70.37%), Postives = 26/27 (96.30%), Query Frame = 3
Query:   24 RWTVQGMTALVTGGTKGLGHAVVEELA 104
            RW+++G TALVTGG+KG+G+A+VEELA
Sbjct:   16 RWSLKGTTALVTGGSKGIGYAIVEELA 42          
BLAST of CF503805 vs. ExPASy Swiss-Prot
Match: TRN2_HYONI (Tropinone reductase 2 OS=Hyoscyamus niger GN=TR2 PE=2 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.584e-32
Identity = 53/96 (55.21%), Postives = 71/96 (73.96%), Query Frame = 2
Query:  119 AVHTCSRNEADLSECIRDWKTKGFKVTGSVCDVSSRIEREKLINQVSSLFDGKLNILINNVGTTIRKATVEYTAEDFSFLMATNFESAYNLCQLAH 406
            +V+TCSRN+ +L EC+  W++KGF V  SVCD+SSR ERE+ +  VS+ F GKLNIL+NN G  I K   +YT ED+S +M+ NFE+AY+L  LAH
Sbjct:   35 SVYTCSRNQKELDECLTQWRSKGFNVEASVCDLSSRSEREEFMKTVSNHFHGKLNILVNNAGIVIYKEAKDYTMEDYSHIMSINFEAAYHLSVLAH 130          

HSP 2 Score: 43.8986 bits (102), Expect = 1.584e-32
Identity = 17/27 (62.96%), Postives = 24/27 (88.89%), Query Frame = 3
Query:   24 RWTVQGMTALVTGGTKGLGHAVVEELA 104
            RW ++G TALVTGG++G+G+ +VEELA
Sbjct:    4 RWNLEGCTALVTGGSRGIGYGIVEELA 30          
The following BLAST results are available for this feature:
BLAST of CF503805 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 5
Match NameE-valueIdentityDescription
TRNH_DATST1.696e-3862.11Tropinone reductase homolog OS=Datura stramonium P... [more]
TRNH1_ARATH1.081e-3764.21Tropinone reductase homolog At1g07440 OS=Arabidops... [more]
TRN2_DATST1.128e-3354.00Tropinone reductase 2 OS=Datura stramonium GN=TR2 ... [more]
TRN1_DATST1.912e-3353.68Tropinone reductase 1 OS=Datura stramonium GN=TR1 ... [more]
TRN2_HYONI1.584e-3255.21Tropinone reductase 2 OS=Hyoscyamus niger GN=TR2 P... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-291 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-10_A04 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF503805 ID=CF503805|Name=CF503805|organism=Citrus sinensis|type=EST|length=407bp
ACGGCAATGGCAGGCTCAATCAGAGATGGACTGTCCAGGGAATGACTGCG
CTTGTAACTGGTGGAACCAAAGGACTAGGTCATGCTGTAGTGGAGGAACT
GGCTGAGCCTTGGTGCCCGCTGTGCATACATGCTCTAGGAATGAAGCAGA
TCTTAGTGAATGCATACGTGACTGGAAAACTAAAGGCTTCAAAGTCACCG
GTTCAGTGTGCGATGTATCATCTCGAATTGAACGGGAAAAGCTTATAAAC
CAAGTCTCCTCTCTGTTCGATGGAAAACTTAACATTCTCATAAACAACGT
CGGGACGACTATAAGAAAGGCGACTGTGGAGTACACAGCAGAAGATTTCT
CGTTTCTCATGGCTACCAATTTTGAGTCTGCTTACAATCTGTGCCAACTT
GCACATC
back to top