CF503806

Overview
NameCF503806
Unique NameCF503806
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length272
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF503806 vs. ExPASy Swiss-Prot
Match: BIP4_TOBAC (Luminal-binding protein 4 OS=Nicotiana tabacum GN=BIP4 PE=2 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 1.601e-45
Identity = 88/90 (97.78%), Postives = 90/90 (100.00%), Query Frame = 2
Query:    2 DAGIIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSILTIDNGVFEVLSTNGDTHLGGEDFDQRVMEYFIKLIKKKHG 271
            DAG+IAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSILTIDNGVFEVLSTNGDTHLGGEDFDQR+MEYFIKLIKKKHG
Sbjct:  194 DAGVIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSILTIDNGVFEVLSTNGDTHLGGEDFDQRIMEYFIKLIKKKHG 283          
BLAST of CF503806 vs. ExPASy Swiss-Prot
Match: BIP_SOLLC (Luminal-binding protein OS=Solanum lycopersicum PE=2 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 3.567e-45
Identity = 87/90 (96.67%), Postives = 90/90 (100.00%), Query Frame = 2
Query:    2 DAGIIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSILTIDNGVFEVLSTNGDTHLGGEDFDQRVMEYFIKLIKKKHG 271
            DAG+IAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSILTIDNGVFEVL+TNGDTHLGGEDFDQR+MEYFIKLIKKKHG
Sbjct:  193 DAGVIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSILTIDNGVFEVLATNGDTHLGGEDFDQRIMEYFIKLIKKKHG 282          
BLAST of CF503806 vs. ExPASy Swiss-Prot
Match: BIP5_TOBAC (Luminal-binding protein 5 OS=Nicotiana tabacum GN=BIP5 PE=2 SV=1)

HSP 1 Score: 179.874 bits (455), Expect = 3.567e-45
Identity = 87/90 (96.67%), Postives = 90/90 (100.00%), Query Frame = 2
Query:    2 DAGIIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSILTIDNGVFEVLSTNGDTHLGGEDFDQRVMEYFIKLIKKKHG 271
            DAG+IAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSILTIDNGVFEVL+TNGDTHLGGEDFDQR+MEYFIKLIKKKHG
Sbjct:  193 DAGVIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSILTIDNGVFEVLATNGDTHLGGEDFDQRIMEYFIKLIKKKHG 282          
BLAST of CF503806 vs. ExPASy Swiss-Prot
Match: BIP1_ARATH (Luminal-binding protein 1 OS=Arabidopsis thaliana GN=At5g28540 PE=1 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 3.020e-44
Identity = 86/89 (96.63%), Postives = 88/89 (98.88%), Query Frame = 2
Query:    2 DAGIIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSILTIDNGVFEVLSTNGDTHLGGEDFDQRVMEYFIKLIKKKH 268
            DAG+IAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVS+LTIDNGVFEVLSTNGDTHLGGEDFD RVMEYFIKLIKKKH
Sbjct:  192 DAGVIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSVLTIDNGVFEVLSTNGDTHLGGEDFDHRVMEYFIKLIKKKH 280          
BLAST of CF503806 vs. ExPASy Swiss-Prot
Match: BIP2_ARATH (Luminal-binding protein 2 OS=Arabidopsis thaliana GN=At5g42020 PE=1 SV=2)

HSP 1 Score: 176.407 bits (446), Expect = 3.944e-44
Identity = 85/89 (95.51%), Postives = 88/89 (98.88%), Query Frame = 2
Query:    2 DAGIIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSILTIDNGVFEVLSTNGDTHLGGEDFDQRVMEYFIKLIKKKH 268
            DAG+IAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVS+LTIDNGVFEVLSTNGDTHLGGEDFD R+MEYFIKLIKKKH
Sbjct:  192 DAGVIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSVLTIDNGVFEVLSTNGDTHLGGEDFDHRIMEYFIKLIKKKH 280          
BLAST of CF503806 vs. ExPASy Swiss-Prot
Match: BIP_SPIOL (Luminal-binding protein OS=Spinacia oleracea GN=HSC70 PE=2 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 8.786e-44
Identity = 84/89 (94.38%), Postives = 89/89 (100.00%), Query Frame = 2
Query:    2 DAGIIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSILTIDNGVFEVLSTNGDTHLGGEDFDQRVMEYFIKLIKKKH 268
            DAG+IAGLNVARIINEPTAAAIAYGLDK+GGEKNILVFDLGGGTFDVS+LTIDNGVFEVL+TNGDTHLGGEDFDQR+MEYFIKLIKKKH
Sbjct:  193 DAGVIAGLNVARIINEPTAAAIAYGLDKRGGEKNILVFDLGGGTFDVSVLTIDNGVFEVLATNGDTHLGGEDFDQRLMEYFIKLIKKKH 281          
BLAST of CF503806 vs. ExPASy Swiss-Prot
Match: BIP3_MAIZE (Luminal-binding protein 3 OS=Zea mays GN=BIPE3 PE=2 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 8.786e-44
Identity = 85/89 (95.51%), Postives = 89/89 (100.00%), Query Frame = 2
Query:    2 DAGIIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSILTIDNGVFEVLSTNGDTHLGGEDFDQRVMEYFIKLIKKKH 268
            DAG+IAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSILTIDNGVFEVL+TNGDTHLGGEDFDQR+MEYFIKLIKKK+
Sbjct:  190 DAGVIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSILTIDNGVFEVLATNGDTHLGGEDFDQRIMEYFIKLIKKKY 278          
BLAST of CF503806 vs. ExPASy Swiss-Prot
Match: BIP2_MAIZE (Luminal-binding protein 2 OS=Zea mays GN=BIPE2 PE=1 SV=3)

HSP 1 Score: 175.252 bits (443), Expect = 8.786e-44
Identity = 85/89 (95.51%), Postives = 89/89 (100.00%), Query Frame = 2
Query:    2 DAGIIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSILTIDNGVFEVLSTNGDTHLGGEDFDQRVMEYFIKLIKKKH 268
            DAG+IAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSILTIDNGVFEVL+TNGDTHLGGEDFDQR+MEYFIKLIKKK+
Sbjct:  190 DAGVIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSILTIDNGVFEVLATNGDTHLGGEDFDQRIMEYFIKLIKKKY 278          
BLAST of CF503806 vs. ExPASy Swiss-Prot
Match: HSP7C_CAEEL (Heat shock 70 kDa protein C OS=Caenorhabditis elegans GN=hsp-3 PE=2 SV=2)

HSP 1 Score: 166.777 bits (421), Expect = 3.125e-41
Identity = 82/90 (91.11%), Postives = 85/90 (94.44%), Query Frame = 2
Query:    2 DAGIIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSILTIDNGVFEVLSTNGDTHLGGEDFDQRVMEYFIKLIKKKHG 271
            DAG IAGLNV RIINEPTAAAIAYGLDKK GE+NILVFDLGGGTFDVS+LTIDNGVFEVL+TNGDTHLGGEDFDQRVMEYFIKL KKK G
Sbjct:  191 DAGTIAGLNVVRIINEPTAAAIAYGLDKKDGERNILVFDLGGGTFDVSMLTIDNGVFEVLATNGDTHLGGEDFDQRVMEYFIKLYKKKSG 280          
BLAST of CF503806 vs. ExPASy Swiss-Prot
Match: HSP7C_CAEBR (Heat shock 70 kDa protein C OS=Caenorhabditis briggsae GN=hsp-3 PE=3 SV=2)

HSP 1 Score: 166.777 bits (421), Expect = 3.125e-41
Identity = 82/90 (91.11%), Postives = 85/90 (94.44%), Query Frame = 2
Query:    2 DAGIIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSILTIDNGVFEVLSTNGDTHLGGEDFDQRVMEYFIKLIKKKHG 271
            DAG IAGLNV RIINEPTAAAIAYGLDKK GE+NILVFDLGGGTFDVS+LTIDNGVFEVL+TNGDTHLGGEDFDQRVMEYFIKL KKK G
Sbjct:  191 DAGTIAGLNVVRIINEPTAAAIAYGLDKKDGERNILVFDLGGGTFDVSMLTIDNGVFEVLATNGDTHLGGEDFDQRVMEYFIKLYKKKSG 280          
The following BLAST results are available for this feature:
BLAST of CF503806 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 500
Match NameE-valueIdentityDescription
BIP4_TOBAC1.601e-4597.78Luminal-binding protein 4 OS=Nicotiana tabacum GN=... [more]
BIP_SOLLC3.567e-4596.67Luminal-binding protein OS=Solanum lycopersicum PE... [more]
BIP5_TOBAC3.567e-4596.67Luminal-binding protein 5 OS=Nicotiana tabacum GN=... [more]
BIP1_ARATH3.020e-4496.63Luminal-binding protein 1 OS=Arabidopsis thaliana ... [more]
BIP2_ARATH3.944e-4495.51Luminal-binding protein 2 OS=Arabidopsis thaliana ... [more]
BIP_SPIOL8.786e-4494.38Luminal-binding protein OS=Spinacia oleracea GN=HS... [more]
BIP3_MAIZE8.786e-4495.51Luminal-binding protein 3 OS=Zea mays GN=BIPE3 PE=... [more]
BIP2_MAIZE8.786e-4495.51Luminal-binding protein 2 OS=Zea mays GN=BIPE2 PE=... [more]
HSP7C_CAEEL3.125e-4191.11Heat shock 70 kDa protein C OS=Caenorhabditis eleg... [more]
HSP7C_CAEBR3.125e-4191.11Heat shock 70 kDa protein C OS=Caenorhabditis brig... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-292 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-10_A05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF503806 ID=CF503806|Name=CF503806|organism=Citrus sinensis|type=EST|length=272bp
GGATGCTGGTATTATTGCTGGGCTAAATGTTGCTAGGATTATCAATGAAC
CAACAGCCGCTGCCATTGCCTATGGATTGGACAAGAAAGGTGGTGAGAAG
AACATTCTTGTCTTTGACCTTGGTGGTGGTACATTTGATGTCAGTATCTT
GACAATTGACAATGGTGTTTTCGAGGTTCTTTCCACAAATGGAGACACTC
ATTTGGGAGGTGAGGACTTTGATCAGAGGGTTATGGAGTACTTTATTAAA
TTGATCAAGAAGAAGCATGGAA
back to top