CF503813

Overview
NameCF503813
Unique NameCF503813
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length501
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig5211 contig Csv1_Contig5211:47..547. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF503813 vs. ExPASy Swiss-Prot
Match: MAON_SOLTU (NAD-dependent malic enzyme 59 kDa isoform, mitochondrial OS=Solanum tuberosum PE=1 SV=1)

HSP 1 Score: 258.07 bits (658), Expect = 1.665e-68
Identity = 131/166 (78.92%), Postives = 142/166 (85.54%), Query Frame = 3
Query:    3 KVKPHXXXXXXXXXXXFNEEVLKAMRESDSVKPAIFAMSNPTMNAECTAADAFKHAGENIVFASGSPFENVDLGNGKIGHVNQANNMYLFPGIGLGTLLSGARFITDGMLQQAAECLASYMTDEEIPKGILYPSIDSIRDITAEVGAAVLRAAVEEDLAEGHGEVG 500
            KVKPH           F+EEVL+AM+ESDSV+PAIFAMSNPT NAEC   DAFK AGE+IVFASGSPF NVDLGNGKIGHVNQANNMYLFPGIGLG LLSGAR I+D ML+ AAECLASYM+D+EI +GILYPSID IRDITAEVGAAVLRAAV EDLAEGHG+VG
Sbjct:  405 KVKPHVLLGLSGVGGIFHEEVLRAMKESDSVRPAIFAMSNPTNNAECCPVDAFKLAGEDIVFASGSPFANVDLGNGKIGHVNQANNMYLFPGIGLGALLSGARNISDTMLEAAAECLASYMSDDEINRGILYPSIDDIRDITAEVGAAVLRAAVAEDLAEGHGDVG 570          
BLAST of CF503813 vs. ExPASy Swiss-Prot
Match: MAOM_SOLTU (NAD-dependent malic enzyme 62 kDa isoform, mitochondrial OS=Solanum tuberosum PE=1 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 5.024e-57
Identity = 106/165 (64.24%), Postives = 132/165 (80.00%), Query Frame = 3
Query:    3 KVKPHXXXXXXXXXXXFNEEVLKAMRESDSVKPAIFAMSNPTMNAECTAADAFKHAGENIVFASGSPFENVDLGNGKIGHVNQANNMYLFPGIGLGTLLSGARFITDGMLQQAAECLASYMTDEEIPKGILYPSIDSIRDITAEVGAAVLRAAVEEDLAEGHGEV 497
            +VKP            F++EVL+A++ S S +PAIF MSNPT NAECT  +AF   GENI+FASGSPF++VDLGNG +GH NQANNM+LFPGIGLGTLLSG+R ++DGMLQ AAECLA+Y+T+EE+ KGI+YPSI  IRDIT EV AAV++ A+EEDLAEG+ E+
Sbjct:  428 EVKPDVLLGLSACGGLFSKEVLEALKHSTSTRPAIFPMSNPTRNAECTPEEAFSILGENIIFASGSPFKDVDLGNGHVGHCNQANNMFLFPGIGLGTLLSGSRIVSDGMLQAAAECLAAYITEEEVLKGIIYPSISRIRDITKEVAAAVVKEAIEEDLAEGYREM 592          
BLAST of CF503813 vs. ExPASy Swiss-Prot
Match: MAOM_AMAHP (NAD-dependent malic enzyme 65 kDa isoform, mitochondrial OS=Amaranthus hypochondriacus PE=1 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 4.703e-55
Identity = 104/165 (63.03%), Postives = 129/165 (78.18%), Query Frame = 3
Query:    3 KVKPHXXXXXXXXXXXFNEEVLKAMRESDSVKPAIFAMSNPTMNAECTAADAFKHAGENIVFASGSPFENVDLGNGKIGHVNQANNMYLFPGIGLGTLLSGARFITDGMLQQAAECLASYMTDEEIPKGILYPSIDSIRDITAEVGAAVLRAAVEEDLAEGHGEV 497
            +VKP            F++EVL+A+++S S +PAIFAMSNPT NAECT  +AF   G+++V+ASGSPF++VDLGNGKIGHVNQ NNMYLFPGIGLG LLSG+R I+D M Q AAE LA YMTDEE+  G++YPSI  IRDIT EV AAV++ AVEEDLAEG+ ++
Sbjct:  425 QVKPDVLLGLSAYGGLFSKEVLEALKDSTSTRPAIFAMSNPTKNAECTPEEAFSIVGDHVVYASGSPFKDVDLGNGKIGHVNQGNNMYLFPGIGLGVLLSGSRIISDSMFQAAAERLAGYMTDEEVINGVIYPSISRIRDITKEVAAAVIKEAVEEDLAEGYRDM 589          
BLAST of CF503813 vs. ExPASy Swiss-Prot
Match: MAOX_DICDI (NADP-dependent malic enzyme OS=Dictyostelium discoideum GN=malA PE=2 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 2.432e-27
Identity = 64/159 (40.25%), Postives = 94/159 (59.12%), Query Frame = 3
Query:    6 VKPHXXXXXXXXXXXFNEEVLKAMRESDSVKPAIFAMSNPTMNAECTAADAFKHAGENIVFASGSPFENVDLGNGKIGHVNQANNMYLFPGIGLGTLLSGARFITDGMLQQAAECLASYMTDEEIPKGILYPSIDSIRDITAEVGAAVLRAAVEEDLAE 482
            VKP            F++EV++ M +    KP +FA+SNPT NAECTA  A++      +FASGSPF+ V+   GK     Q NNMY+FPG+GL   +  A+ +TD M+  AA+ LAS++ D E+  G +YP +  IR+I+  +   V+  A EE +A+
Sbjct:  363 VKPTAIIGLSGIGGSFSQEVIEEMAKHVE-KPIVFALSNPTTNAECTAEQAYQWTDGRCIFASGSPFKPVEY-KGKTFVPGQGNNMYIFPGLGLAASVCEAKHVTDAMIITAAKTLASFVEDSEVLTGKIYPGLQHIREISTRIAVKVIEKAYEEGMAQ 519          
BLAST of CF503813 vs. ExPASy Swiss-Prot
Match: MAOX_VITVI (NADP-dependent malic enzyme OS=Vitis vinifera PE=2 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 7.076e-27
Identity = 67/158 (42.41%), Postives = 92/158 (58.23%), Query Frame = 3
Query:    6 VKPHXXXXXXXXXXXFNEEVLKAMRESDSVKPAIFAMSNPTMNAECTAADAFKHAGENIVFASGSPFENVDLGNGKIGHVNQANNMYLFPGIGLGTLLSGARFITDGMLQQAAECLASYMTDEEIPKGILYPSIDSIRDITAEVGAAVLRAAVEEDLA 479
            +KP            F +EV++AM   +  KP I A+SNPT  +ECTA +A+       +FASGSPF+ V+  NGK     QANN Y+FPG+G+G ++SGA  + D ML  A+E LA  +T E   KG++YP   +IR I+A + A V   A E  LA
Sbjct:  410 IKPTVLIGSSGVGKAFTKEVIEAMASCNE-KPLILALSNPTSQSECTAEEAYTWTQGRAIFASGSPFDPVEY-NGKTFVPGQANNAYIFPGLGMGLVISGAIRVHDEMLLAASEALARQVTQENFDKGLIYPPFSNIRKISAHIAANVAAKAYELGLA 565          
BLAST of CF503813 vs. ExPASy Swiss-Prot
Match: MAOX_HUMAN (NADP-dependent malic enzyme OS=Homo sapiens GN=ME1 PE=1 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 1.207e-26
Identity = 60/164 (36.59%), Postives = 96/164 (58.54%), Query Frame = 3
Query:    3 KVKPHXXXXXXXXXXXFNEEVLKAMRESDSVKPAIFAMSNPTMNAECTAADAFKHAGENIVFASGSPFENVDLGNGKIGHVNQANNMYLFPGIGLGTLLSGARFITDGMLQQAAECLASYMTDEEIPKGILYPSIDSIRDITAEVGAAVLRAAVEEDLAEGHGE 494
            ++KP            F+E++LK M   +  +P IFA+SNPT  AEC+A   +K      +FASGSPF+ V L NG+  +  Q NN Y+FPG+ LG +  G R ITD +    AE +A  ++D+ + +G LYP +++IRD++ ++   +++ A +E  A  + E
Sbjct:  370 EIKPTALIGVAAIGGAFSEQILKDMAAFNE-RPIIFALSNPTSKAECSAEQCYKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDNIFLTTAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPE 532          
BLAST of CF503813 vs. ExPASy Swiss-Prot
Match: MAOC_ORYSJ (NADP-dependent malic enzyme, chloroplastic OS=Oryza sativa subsp. japonica GN=ME6 PE=2 SV=2)

HSP 1 Score: 119.013 bits (297), Expect = 1.207e-26
Identity = 67/158 (42.41%), Postives = 95/158 (60.13%), Query Frame = 3
Query:    6 VKPHXXXXXXXXXXXFNEEVLKAMRESDSVKPAIFAMSNPTMNAECTAADAFKHAGENIVFASGSPFENVDLGNGKIGHVNQANNMYLFPGIGLGTLLSGARFITDGMLQQAAECLASYMTDEEIPKGILYPSIDSIRDITAEVGAAVLRAAVEEDLA 479
            +KP            F +EV++AM  S + +P IF++SNPT ++ECTA +A+  +    VFASGSPF+ V+  NGKI    Q+NN Y+FPG GLG ++SGA  + + ML  A+E LA   T E   KG ++P   +IR I+A + A+V   A E  LA
Sbjct:  458 IKPTVLIGTSGVGKTFTKEVIEAMA-SFNERPVIFSLSNPTSHSECTAEEAYNWSQGRAVFASGSPFDPVEY-NGKIHVPGQSNNAYIFPGFGLGVVISGAVRVHEDMLLAASETLADQATQENFEKGSIFPPFTNIRKISARIAASVAAKAYELGLA 613          
BLAST of CF503813 vs. ExPASy Swiss-Prot
Match: MAOX_POPTR (NADP-dependent malic enzyme OS=Populus trichocarpa PE=2 SV=3)

HSP 1 Score: 118.627 bits (296), Expect = 1.576e-26
Identity = 66/158 (41.77%), Postives = 95/158 (60.13%), Query Frame = 3
Query:    6 VKPHXXXXXXXXXXXFNEEVLKAMRESDSVKPAIFAMSNPTMNAECTAADAFKHAGENIVFASGSPFENVDLGNGKIGHVNQANNMYLFPGIGLGTLLSGARFITDGMLQQAAECLASYMTDEEIPKGILYPSIDSIRDITAEVGAAVLRAAVEEDLA 479
            +KP            F +EV++AM  S + KP I A+SNPT  +ECTA +A+       +FASGSPF+ V+   GK+    Q+NN Y+FPG+GLG ++SGA  + D ML  AAE LA  + +E + KG++YP + +IR I+ ++ A V   A E  LA
Sbjct:  410 IKPIVLIGTSGVGKTFTKEVIEAMA-SFNEKPLILALSNPTSQSECTAQEAYTWTKGKAIFASGSPFDPVEY-EGKVFVPGQSNNAYIFPGLGLGLVISGAIRVHDDMLLAAAEALAGQIKEEYLAKGLIYPPLSNIRKISVQIAANVAAKAYELGLA 565          
BLAST of CF503813 vs. ExPASy Swiss-Prot
Match: MAOC_FLAPR (NADP-dependent malic enzyme, chloroplastic OS=Flaveria pringlei GN=MODA PE=2 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 3.512e-26
Identity = 67/158 (42.41%), Postives = 91/158 (57.59%), Query Frame = 3
Query:    6 VKPHXXXXXXXXXXXFNEEVLKAMRESDSVKPAIFAMSNPTMNAECTAADAFKHAGENIVFASGSPFENVDLGNGKIGHVNQANNMYLFPGIGLGTLLSGARFITDGMLQQAAECLASYMTDEEIPKGILYPSIDSIRDITAEVGAAVLRAAVEEDLA 479
            +KP            F +EV++AM  S + KP I A+SNPT  +ECTA  A+  +    +FASGSPF  V+  NGK+    Q+NN Y+FPG GLG ++SGA  + D ML  A+E LA  +T E    G++YP   +IR I+A + A V   A E  LA
Sbjct:  466 IKPTVLIGSSGAGQTFTKEVVEAM-SSFNEKPIILALSNPTSQSECTAEQAYTWSEGRTIFASGSPFAPVEY-NGKVYVSGQSNNAYIFPGFGLGLIISGAIRVHDEMLLAASEALAEQVTQEHFDNGLIYPPFTNIRKISAHIAAKVAAKAYELGLA 621          
BLAST of CF503813 vs. ExPASy Swiss-Prot
Match: MAOX_RAT (NADP-dependent malic enzyme OS=Rattus norvegicus GN=Me1 PE=1 SV=2)

HSP 1 Score: 116.701 bits (291), Expect = 5.991e-26
Identity = 58/164 (35.37%), Postives = 95/164 (57.93%), Query Frame = 3
Query:    3 KVKPHXXXXXXXXXXXFNEEVLKAMRESDSVKPAIFAMSNPTMNAECTAADAFKHAGENIVFASGSPFENVDLGNGKIGHVNQANNMYLFPGIGLGTLLSGARFITDGMLQQAAECLASYMTDEEIPKGILYPSIDSIRDITAEVGAAVLRAAVEEDLAEGHGE 494
            K+KP            F E++LK M   +  +P IFA+SNPT  AEC+A + +K      +FASGSPF+ V L +G+     Q NN Y+FPG+ LG +  G R I D +    AE ++  ++D+ + +G LYP +++IRD++ ++   +++ A +E +A  + E
Sbjct:  370 KIKPTALIGVAAIGGAFTEQILKDMAAFNE-RPIIFALSNPTSKAECSAEECYKVTKGRAIFASGSPFDPVTLPDGRTLFPGQGNNSYVFPGVALGVVACGLRHINDSVFLTTAEVISQQVSDKHLEEGRLYPPLNTIRDVSLKIAVKIVQDAYKEKMATVYPE 532          
The following BLAST results are available for this feature:
BLAST of CF503813 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 140
Match NameE-valueIdentityDescription
MAON_SOLTU1.665e-6878.92NAD-dependent malic enzyme 59 kDa isoform, mitocho... [more]
MAOM_SOLTU5.024e-5764.24NAD-dependent malic enzyme 62 kDa isoform, mitocho... [more]
MAOM_AMAHP4.703e-5563.03NAD-dependent malic enzyme 65 kDa isoform, mitocho... [more]
MAOX_DICDI2.432e-2740.25NADP-dependent malic enzyme OS=Dictyostelium disco... [more]
MAOX_VITVI7.076e-2742.41NADP-dependent malic enzyme OS=Vitis vinifera PE=2... [more]
MAOX_HUMAN1.207e-2636.59NADP-dependent malic enzyme OS=Homo sapiens GN=ME1... [more]
MAOC_ORYSJ1.207e-2642.41NADP-dependent malic enzyme, chloroplastic OS=Oryz... [more]
MAOX_POPTR1.576e-2641.77NADP-dependent malic enzyme OS=Populus trichocarpa... [more]
MAOC_FLAPR3.512e-2642.41NADP-dependent malic enzyme, chloroplastic OS=Flav... [more]
MAOX_RAT5.991e-2635.37NADP-dependent malic enzyme OS=Rattus norvegicus G... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-299 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-10_A12 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF503813 ID=CF503813|Name=CF503813|organism=Citrus sinensis|type=EST|length=501bp
GAAAGGTCAAACCCCATGTGCTTCTTGGTTTGTCTGGCGTAGGTGGTGTC
TTCAATGAAGAGGTGCTTAAGGCTATGCGAGAGTCTGATTCTGTCAAACC
TGCCATTTTTGCTATGTCAAATCCGACCATGAATGCTGAATGCACTGCTG
CTGATGCTTTTAAGCATGCTGGGGAAAATATAGTGTTTGCTAGTGGAAGT
CCTTTTGAGAATGTTGATCTGGGAAATGGGAAAATAGGCCATGTAAATCA
AGCAAATAACATGTATCTGTTCCCTGGGATTGGTTTGGGAACTCTCCTTT
CAGGTGCTCGTTTTATAACAGATGGAATGTTACAACAAGCTGCAGAATGC
CTTGCGTCCTATATGACCGATGAGGAAATTCCAAAAGGCATTCTGTATCC
ATCTATTGACAGTATTCGAGATATTACGGCAGAAGTTGGAGCAGCTGTTC
TACGAGCAGCAGTTGAGGAAGACTTGGCAGAAGGTCATGGTGAAGTTGGT
C
back to top