CF503817

Overview
NameCF503817
Unique NameCF503817
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length407
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig7217 contig Csv1_Contig7217:536..942. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF503817 vs. ExPASy Swiss-Prot
Match: ACOC_CUCMA (Aconitate hydratase, cytoplasmic OS=Cucurbita maxima PE=2 SV=1)

HSP 1 Score: 257.299 bits (656), Expect = 1.770e-68
Identity = 123/135 (91.11%), Postives = 131/135 (97.04%), Query Frame = 1
Query:    1 ELGLQVKPWVKTSLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASAITDNDIVAAAVLSGNRNFEGRVHPLTRANYLASPPLVVAYALAGTVDIDFDKEPIGTTKDGKSVYFKDIWPT 405
            ELGLQVKPWVKTSLAPGSGVVTKYLL+SGLQ YLN+QGFHIVGYGCTTCIGNSGDLDESV++AI+DNDIVAAAVLSGNRNFEGRVHPLTRANYLASPPLVVAYALAGTVDIDF+KEPIG  KDGK VYF+DIWP+
Sbjct:  462 ELGLQVKPWVKTSLAPGSGVVTKYLLKSGLQPYLNQQGFHIVGYGCTTCIGNSGDLDESVSAAISDNDIVAAAVLSGNRNFEGRVHPLTRANYLASPPLVVAYALAGTVDIDFEKEPIGKGKDGKDVYFRDIWPS 596          
BLAST of CF503817 vs. ExPASy Swiss-Prot
Match: ACOC_ORYSJ (Putative aconitate hydratase, cytoplasmic OS=Oryza sativa subsp. japonica GN=Os08g0191100 PE=3 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 1.147e-67
Identity = 119/135 (88.15%), Postives = 132/135 (97.78%), Query Frame = 1
Query:    1 ELGLQVKPWVKTSLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASAITDNDIVAAAVLSGNRNFEGRVHPLTRANYLASPPLVVAYALAGTVDIDFDKEPIGTTKDGKSVYFKDIWPT 405
            ELGL+VKPWVKTSLAPGSGVVTKYLLQSGLQ+YLN+QGFH+VGYGCTTCIGNSGDLDESV++AI++ND+VAAAVLSGNRNFEGRVHPLTRANYLASPPLVVAYALAGTVDIDF+KEPIG  KDGK V+F+DIWP+
Sbjct:  462 ELGLEVKPWVKTSLAPGSGVVTKYLLQSGLQEYLNKQGFHVVGYGCTTCIGNSGDLDESVSAAISENDVVAAAVLSGNRNFEGRVHPLTRANYLASPPLVVAYALAGTVDIDFEKEPIGVGKDGKEVFFRDIWPS 596          
BLAST of CF503817 vs. ExPASy Swiss-Prot
Match: ACOC_SOLTU (Aconitate hydratase, cytoplasmic (Fragment) OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 251.906 bits (642), Expect = 7.436e-67
Identity = 121/135 (89.63%), Postives = 130/135 (96.30%), Query Frame = 1
Query:    1 ELGLQVKPWVKTSLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASAITDNDIVAAAVLSGNRNFEGRVHPLTRANYLASPPLVVAYALAGTVDIDFDKEPIGTTKDGKSVYFKDIWPT 405
            ELGL VKPWVKTSLAPGSGVVTKYLL+SGLQKYLN+QGF+IVGYGCTTCIGNSGDLDESVASAI++NDIVAAAVLSGNRNFEGRVH LTRANYLASPPLVVAYALAGTVDIDF+K+PIG  KDGK VYF+DIWP+
Sbjct:  180 ELGLHVKPWVKTSLAPGSGVVTKYLLKSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVASAISENDIVAAAVLSGNRNFEGRVHALTRANYLASPPLVVAYALAGTVDIDFEKDPIGVGKDGKDVYFRDIWPS 314          
BLAST of CF503817 vs. ExPASy Swiss-Prot
Match: ACO2M_ARATH (Aconitate hydratase 2, mitochondrial OS=Arabidopsis thaliana GN=ACO2 PE=1 SV=2)

HSP 1 Score: 241.891 bits (616), Expect = 7.695e-64
Identity = 114/135 (84.44%), Postives = 129/135 (95.56%), Query Frame = 1
Query:    1 ELGLQVKPWVKTSLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASAITDNDIVAAAVLSGNRNFEGRVHPLTRANYLASPPLVVAYALAGTVDIDFDKEPIGTTKDGKSVYFKDIWPT 405
            +LGLQVKPW+KTSLAPGSGVVTKYLL+SGLQ+YLNEQGF+IVGYGCTTCIGNSG+++ESV +AIT+NDIVAAAVLSGNRNFEGRVHPLTRANYLASPPLVVAYALAGTV+IDF+ EPIG  K+GK V+ +DIWPT
Sbjct:  554 DLGLQVKPWIKTSLAPGSGVVTKYLLKSGLQEYLNEQGFNIVGYGCTTCIGNSGEINESVGAAITENDIVAAAVLSGNRNFEGRVHPLTRANYLASPPLVVAYALAGTVNIDFETEPIGKGKNGKDVFLRDIWPT 688          
BLAST of CF503817 vs. ExPASy Swiss-Prot
Match: ACO1_ARATH (Aconitate hydratase 1 OS=Arabidopsis thaliana GN=ACO1 PE=1 SV=2)

HSP 1 Score: 241.121 bits (614), Expect = 1.313e-63
Identity = 112/135 (82.96%), Postives = 127/135 (94.07%), Query Frame = 1
Query:    1 ELGLQVKPWVKTSLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASAITDNDIVAAAVLSGNRNFEGRVHPLTRANYLASPPLVVAYALAGTVDIDFDKEPIGTTKDGKSVYFKDIWPT 405
            +LGL+VKPW+KTSLAPGSGVVTKYL +SGLQKYLN+ GF IVGYGCTTCIGNSGD+ E+VASAI DND+VA+AVLSGNRNFEGRVHPLTRANYLASPPLVVAYALAGTVDIDF+ +PIGT KDGK ++F+DIWP+
Sbjct:  462 DLGLEVKPWIKTSLAPGSGVVTKYLAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVDNDLVASAVLSGNRNFEGRVHPLTRANYLASPPLVVAYALAGTVDIDFETQPIGTGKDGKQIFFRDIWPS 596          
BLAST of CF503817 vs. ExPASy Swiss-Prot
Match: ACOC_CUCMC (Aconitate hydratase (Fragment) OS=Cucumis melo var. conomon GN=ACO PE=2 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 1.451e-62
Identity = 114/135 (84.44%), Postives = 123/135 (91.11%), Query Frame = 1
Query:    1 ELGLQVKPWVKTSLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASAITDNDIVAAAVLSGNRNFEGRVHPLTRANYLASPPLVVAYALAGTVDIDFDKEPIGTTKDGKSVYFKDIWPT 405
            ELGL+VKPW+KT L    GVVTKYL +SGLQKYLN+ GF+IVGYGCTTCIGNSGD+DESVASAIT NDIVAAAVLSGNRNFEGRVHPLTRANYLASPPLVVAYALAGTVDIDF+ EPIG  KDGK V+F+DIWPT
Sbjct:  327 ELGLEVKPWIKTVLLQALGVVTKYLAKSGLQKYLNQLGFNIVGYGCTTCIGNSGDIDESVASAITGNDIVAAAVLSGNRNFEGRVHPLTRANYLASPPLVVAYALAGTVDIDFESEPIGVGKDGKKVFFRDIWPT 461          
BLAST of CF503817 vs. ExPASy Swiss-Prot
Match: ACO3M_ARATH (Aconitate hydratase 3, mitochondrial OS=Arabidopsis thaliana GN=ACO3 PE=1 SV=2)

HSP 1 Score: 221.861 bits (564), Expect = 8.241e-58
Identity = 107/135 (79.26%), Postives = 119/135 (88.15%), Query Frame = 1
Query:    1 ELGLQVKPWVKTSLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASAITDNDIVAAAVLSGNRNFEGRVHPLTRANYLASPPLVVAYALAGTVDIDFDKEPIGTTKDGKSVYFKDIWPT 405
            +LGL+VKPWVKTSLAPGS VV KYL +SGL++ L +QGF IVGYGCTTCIGNSG+LD  VASAI   DI+ AAVLSGNRNFEGRVHP TRANYLASPPLVVAYALAGTVDIDF+KEPIGT  DGKSVY +D+WP+
Sbjct:  559 DLGLKVKPWVKTSLAPGSRVVEKYLDRSGLRESLTKQGFEIVGYGCTTCIGNSGNLDPEVASAIEGTDIIPAAVLSGNRNFEGRVHPQTRANYLASPPLVVAYALAGTVDIDFEKEPIGTRSDGKSVYLRDVWPS 693          
BLAST of CF503817 vs. ExPASy Swiss-Prot
Match: ACOC_CHICK (Cytoplasmic aconitate hydratase OS=Gallus gallus GN=ACO1 PE=2 SV=1)

HSP 1 Score: 202.986 bits (515), Expect = 3.961e-52
Identity = 94/135 (69.63%), Postives = 111/135 (82.22%), Query Frame = 1
Query:    1 ELGLQVKPWVKTSLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASAITDNDIVAAAVLSGNRNFEGRVHPLTRANYLASPPLVVAYALAGTVDIDFDKEPIGTTKDGKSVYFKDIWPT 405
            E GL VKP++KTSL+PGSGVVT YL +SG+  YL++ GF +VGYGC TCIGNSG L +SV  AIT  D+VA  VLSGNRNFEGRVHP TRANYLASPPLV+AYA+AGTV IDF+KEP+G +  GK ++ KDIWPT
Sbjct:  458 EAGLTVKPYIKTSLSPGSGVVTYYLRESGVMSYLSQLGFDVVGYGCMTCIGNSGPLPDSVVEAITQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTVRIDFEKEPLGISASGKKIFLKDIWPT 592          
BLAST of CF503817 vs. ExPASy Swiss-Prot
Match: ACOC_RAT (Cytoplasmic aconitate hydratase OS=Rattus norvegicus GN=Aco1 PE=1 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 1.153e-51
Identity = 95/135 (70.37%), Postives = 109/135 (80.74%), Query Frame = 1
Query:    1 ELGLQVKPWVKTSLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASAITDNDIVAAAVLSGNRNFEGRVHPLTRANYLASPPLVVAYALAGTVDIDFDKEPIGTTKDGKSVYFKDIWPT 405
            E GL VKP+VKTSL+PGSGVVT YL +SG+  YL++ GF +VGYGC TCIGNSG L E V  AIT  D+VA  VLSGNRNFEGRVHP TRANYLASPPLV+AYA+AGTV IDF+KEP+G    G+ V+ KDIWPT
Sbjct:  458 EAGLNVKPYVKTSLSPGSGVVTYYLRESGVMPYLSQLGFDVVGYGCMTCIGNSGPLPEPVVEAITQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTVRIDFEKEPLGVNAQGQQVFLKDIWPT 592          
BLAST of CF503817 vs. ExPASy Swiss-Prot
Match: ACOC_MOUSE (Cytoplasmic aconitate hydratase OS=Mus musculus GN=Aco1 PE=1 SV=2)

HSP 1 Score: 201.445 bits (511), Expect = 1.153e-51
Identity = 94/135 (69.63%), Postives = 109/135 (80.74%), Query Frame = 1
Query:    1 ELGLQVKPWVKTSLAPGSGVVTKYLLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASAITDNDIVAAAVLSGNRNFEGRVHPLTRANYLASPPLVVAYALAGTVDIDFDKEPIGTTKDGKSVYFKDIWPT 405
            E GL VKP++KTSL+PGSGVVT YL +SG+  YL++ GF +VGYGC TCIGNSG L E V  AIT  D+VA  VLSGNRNFEGRVHP TRANYLASPPLV+AYA+AGTV IDF+KEP+G    G+ V+ KDIWPT
Sbjct:  458 EAGLSVKPYIKTSLSPGSGVVTYYLRESGVMPYLSQLGFDVVGYGCMTCIGNSGPLPEPVVEAITQGDLVAVGVLSGNRNFEGRVHPNTRANYLASPPLVIAYAIAGTVRIDFEKEPLGVNAQGRQVFLKDIWPT 592          
The following BLAST results are available for this feature:
BLAST of CF503817 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 48
Match NameE-valueIdentityDescription
ACOC_CUCMA1.770e-6891.11Aconitate hydratase, cytoplasmic OS=Cucurbita maxi... [more]
ACOC_ORYSJ1.147e-6788.15Putative aconitate hydratase, cytoplasmic OS=Oryza... [more]
ACOC_SOLTU7.436e-6789.63Aconitate hydratase, cytoplasmic (Fragment) OS=Sol... [more]
ACO2M_ARATH7.695e-6484.44Aconitate hydratase 2, mitochondrial OS=Arabidopsi... [more]
ACO1_ARATH1.313e-6382.96Aconitate hydratase 1 OS=Arabidopsis thaliana GN=A... [more]
ACOC_CUCMC1.451e-6284.44Aconitate hydratase (Fragment) OS=Cucumis melo var... [more]
ACO3M_ARATH8.241e-5879.26Aconitate hydratase 3, mitochondrial OS=Arabidopsi... [more]
ACOC_CHICK3.961e-5269.63Cytoplasmic aconitate hydratase OS=Gallus gallus G... [more]
ACOC_RAT1.153e-5170.37Cytoplasmic aconitate hydratase OS=Rattus norvegic... [more]
ACOC_MOUSE1.153e-5169.63Cytoplasmic aconitate hydratase OS=Mus musculus GN... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-304 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-10_B05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF503817 ID=CF503817|Name=CF503817|organism=Citrus sinensis|type=EST|length=407bp
GAACTTGGTTTGCAGGTCAAGCCATGGGTTAAAACAAGTCTTGCCCCAGG
CTCAGGAGTTGTTACTAAATATTTACTCCAGAGTGGACTGCAAAAATATT
TAAATGAGCAAGGATTCCATATTGTTGGATATGGATGCACAACATGTATT
GGAAATTCAGGGGATCTGGATGAATCTGTTGCATCTGCTATTACTGACAA
TGACATTGTGGCAGCAGCTGTGCTTTCTGGAAACAGGAATTTTGAGGGTC
GTGTTCATCCCTTGACAAGAGCTAATTACCTTGCTTCTCCTCCTTTAGTT
GTGGCATATGCCCTTGCTGGCACGGTTGACATAGATTTTGATAAGGAGCC
GATTGGAACAACCAAGGATGGTAAGAGTGTTTATTTCAAGGATATCTGGC
CGACTAC
back to top