CF503825

Overview
NameCF503825
Unique NameCF503825
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length435
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF503825 vs. ExPASy Swiss-Prot
Match: MT797_ARATH (Probable S-adenosylmethionine-dependent methyltransferase At5g37970 OS=Arabidopsis thaliana GN=At5g37970 PE=1 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 3.564e-30
Identity = 63/143 (44.06%), Postives = 91/143 (63.64%), Query Frame = 3
Query:    3 GSFHGRLFPKSTLHVVNSFNAMHWLSKTPKVNMLEKSLEWNQGSIKCTRFMKGVHETFQAQFRSDFESILNARAEELVPGGLMVFSLITGPSGIPFADTVQGATYNFLGSCLWDLAKMGVISEEKVCTFNVPAYFPYVEELES 431
            GSFHGR+ PK++LH+ ++   +HWLS  P+    +KS   N+  I+C   +  V + ++ QFR DF   L ARAEELV GGLM+ S    P GIP A T QG   + +G CL DLAK+G+ S+EK+  F++P Y P++ E ++
Sbjct:  135 GSFHGRVLPKNSLHIGHTSYTLHWLSNVPQHVCDKKSPALNKSYIQCNNLVDEVTKAYKIQFRKDFGGFLEARAEELVSGGLMILSGQCLPDGIPKALTWQGVVIDMIGDCLMDLAKLGITSKEKIELFSLPTYIPHISEFKA 277          
BLAST of CF503825 vs. ExPASy Swiss-Prot
Match: MT810_ARATH (Probable S-adenosylmethionine-dependent methyltransferase At5g38100 OS=Arabidopsis thaliana GN=At5g38100 PE=2 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 1.037e-29
Identity = 60/142 (42.25%), Postives = 90/142 (63.38%), Query Frame = 3
Query:    3 GSFHGRLFPKSTLHVVNSFNAMHWLSKTPKVNMLEKSLEWNQGSIKCTRFMKGVHETFQAQFRSDFESILNARAEELVPGGLMVFSLITGPSGIPFADTVQGATYNFLGSCLWDLAKMGVISEEKVCTFNVPAYFPYVEELE 428
            GSF+GR+ P++++H+ ++    HWLSK P     +KS+ WN+  I+C   ++ V + ++ QF  D E  L+ARAEELVPGGLM+      P G+   +T QG   + +G CL D+AK G+ SEEK+  F++P YFP   EL+
Sbjct:  132 GSFYGRVLPRNSIHIGHTSYTTHWLSKVPDNVCDKKSMAWNKNYIQCNNLLEEVTKAYKVQFIKDMEIFLDARAEELVPGGLMIVIGECLPDGVSLYETWQGYVMDTIGDCLMDMAKSGITSEEKIDLFSLPVYFPQFSELK 273          
BLAST of CF503825 vs. ExPASy Swiss-Prot
Match: MT878_ARATH (Probable S-adenosylmethionine-dependent methyltransferase At5g38780 OS=Arabidopsis thaliana GN=At5g38780 PE=2 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 2.310e-29
Identity = 61/142 (42.96%), Postives = 87/142 (61.27%), Query Frame = 3
Query:    3 GSFHGRLFPKSTLHVVNSFNAMHWLSKTPKVNMLEKSLEWNQGSIKCTRFMKGVHETFQAQFRSDFESILNARAEELVPGGLMVFSLITGPSGIPFADTVQGATYNFLGSCLWDLAKMGVISEEKVCTFNVPAYFPYVEELE 428
            GSF+GR+ P++++H+ N+    HWLSK P+    + SL WN+  I C   ++ V E ++ QF  D    L ARAEELVPGGLM+      P G+   +T  G   + +G CL D+A +GV +EEK+  FN+P YFP V EL+
Sbjct:  134 GSFYGRVLPRNSIHIGNTSFTTHWLSKVPEEVCDKNSLAWNKNYIHCNNLIEEVTEAYKVQFEKDMGVFLKARAEELVPGGLMITLGQCLPDGVAMYETWSGIVKDTIGDCLQDMATLGVTTEEKIEMFNLPVYFPQVSELK 275          
BLAST of CF503825 vs. ExPASy Swiss-Prot
Match: MT799_ARATH (Probable S-adenosylmethionine-dependent methyltransferase At5g37990 OS=Arabidopsis thaliana GN=At5g37990 PE=2 SV=2)

HSP 1 Score: 125.946 bits (315), Expect = 6.721e-29
Identity = 60/143 (41.96%), Postives = 90/143 (62.94%), Query Frame = 3
Query:    3 GSFHGRLFPKSTLHVVNSFNAMHWLSKTPKVNMLEKSLEWNQGSIKCTRFMKGVHETFQAQFRSDFESILNARAEELVPGGLMVFSLITGPSGIPFADTVQGATYNFLGSCLWDLAKMGVISEEKVCTFNVPAYFPYVEELES 431
            GSFHGR+ PK++LH+ +   A+HWLS  P+    +KS   N+  I+C   ++ V E ++ QF+ D    L ARAEELV GGLM+ S    P G+P A T QG   + +G CL D+AK G+ ++EK+  F++P Y P++ E ++
Sbjct:  135 GSFHGRVLPKNSLHIGHITYALHWLSTVPQHVCDKKSPALNKSYIQCNNLVEEVTEAYRVQFKKDMGDFLGARAEELVSGGLMILSGQCLPDGVPKALTWQGVVIDMIGDCLMDMAKQGITTKEKIELFSLPIYIPHISEFKA 277          
BLAST of CF503825 vs. ExPASy Swiss-Prot
Match: JMT_BRARP (Jasmonate O-methyltransferase OS=Brassica rapa subsp. pekinensis GN=JMT PE=1 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 1.501e-20
Identity = 61/152 (40.13%), Postives = 89/152 (58.55%), Query Frame = 3
Query:    3 GSFHGRLFPKSTLHVVNSFNAMHWLSKTP--KVN-----MLEKSLEWNQGSIKCTRFM-KGVHETFQAQFRSDFESILNARAEELVPGGLMVFSLITGPSGIPFADTVQGATYNF--LGSCLWDLAKMGVISEEKVCTFNVPAYFPYVEELE 428
            GSF+GRLFP+ +LH V+S +++HWLS+ P  +VN     ++   L+ N+G I  ++   K  H+ +  QF++DF   L +R+EELVPGG MV S +   S  P   T + + Y +  L   L  LAK G+I EE +  FN P Y    EEL+
Sbjct:  144 GSFYGRLFPRRSLHFVHSSSSLHWLSQVPCGEVNKKDGVVITADLD-NRGKIYLSKTSPKSAHKVYALQFQTDFSVFLRSRSEELVPGGRMVLSFLGRSSPDP---TTEESCYQWELLAQALMSLAKEGIIEEENIDAFNAPYYAASPEELK 291          
BLAST of CF503825 vs. ExPASy Swiss-Prot
Match: JMT_ARATH (Jasmonate O-methyltransferase OS=Arabidopsis thaliana GN=JMT PE=1 SV=2)

HSP 1 Score: 96.6709 bits (239), Expect = 4.367e-20
Identity = 60/151 (39.74%), Postives = 86/151 (56.95%), Query Frame = 3
Query:    3 GSFHGRLFPKSTLHVVNSFNAMHWLSKTP------KVNMLEKSLEWNQGSIKCTRFM-KGVHETFQAQFRSDFESILNARAEELVPGGLMVFSLITGPSGIPFADTVQGATYNF--LGSCLWDLAKMGVISEEKVCTFNVPAYFPYVEELE 428
            GSF+GRLFP+ +LH V+S +++HWLS+ P      +   +   LE N G I  ++   K  H+ +  QF++DF   L +R+EELVPGG MV S +   S  P   T + + Y +  L   L  +AK G+I EEK+  FN P Y    EEL+
Sbjct:  141 GSFYGRLFPRRSLHFVHSSSSLHWLSQVPCREAEKEDRTITADLE-NMGKIYISKTSPKSAHKAYALQFQTDFLVFLRSRSEELVPGGRMVLSFLGRRSLDP---TTEESCYQWELLAQALMSMAKEGIIEEEKIDAFNAPYYAASSEELK 287          
BLAST of CF503825 vs. ExPASy Swiss-Prot
Match: BAMT_ANTMA (Benzoate carboxyl methyltransferase OS=Antirrhinum majus GN=BAMT PE=1 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 3.238e-15
Identity = 49/145 (33.79%), Postives = 73/145 (50.34%), Query Frame = 3
Query:    3 GSFHGRLFPKSTLHVVNSFNAMHWLSKTPKVNMLEKSLEWN--QGSIKCTRFMKGVHETFQAQFRSDFESILNARAEELVPGGLMVFSLITGPSGIPFADTVQGATYNFLGSCLWDLAKMGVISEEKVCTFNVPAYFPYVEELES 431
            GSF+GRL PK +LH   S  ++HWLS+ P      + LE N  Q     T     V++ +  Q+  DF + L  R EE+VPGG MV +   G S    +     A +  L   L D+   G++  + + +FN+P Y P   E+E+
Sbjct:  128 GSFYGRLLPKKSLHFAYSSYSIHWLSQVP------EGLEDNNRQNIYMATESPPEVYKAYAKQYERDFSTFLKLRGEEIVPGGRMVLT-FNGRSVEDPSSKDDLAIFTLLAKTLVDMVAEGLVKMDDLYSFNIPIYSPCTREVEA 265          
The following BLAST results are available for this feature:
BLAST of CF503825 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 7
Match NameE-valueIdentityDescription
MT797_ARATH3.564e-3044.06Probable S-adenosylmethionine-dependent methyltran... [more]
MT810_ARATH1.037e-2942.25Probable S-adenosylmethionine-dependent methyltran... [more]
MT878_ARATH2.310e-2942.96Probable S-adenosylmethionine-dependent methyltran... [more]
MT799_ARATH6.721e-2941.96Probable S-adenosylmethionine-dependent methyltran... [more]
JMT_BRARP1.501e-2040.13Jasmonate O-methyltransferase OS=Brassica rapa sub... [more]
JMT_ARATH4.367e-2039.74Jasmonate O-methyltransferase OS=Arabidopsis thali... [more]
BAMT_ANTMA3.238e-1533.79Benzoate carboxyl methyltransferase OS=Antirrhinum... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-312 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-10_C01 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF503825 ID=CF503825|Name=CF503825|organism=Citrus sinensis|type=EST|length=435bp
CGGGTTCTTTCCATGGCCGTTTGTTTCCCAAATCTACATTACATGTTGTA
AACTCCTTCAATGCAATGCACTGGCTCTCCAAGACTCCAAAAGTTAATAT
GCTAGAAAAATCTCTTGAGTGGAATCAAGGAAGTATCAAATGCACAAGGT
TCATGAAAGGAGTGCATGAGACATTTCAAGCTCAGTTCAGGAGCGACTTT
GAGTCCATTTTGAATGCTAGAGCCGAAGAACTTGTGCCTGGAGGATTGAT
GGTCTTTTCATTAATTACTGGACCAAGTGGGATCCCTTTCGCTGATACCG
TTCAGGGAGCAACATATAACTTTCTCGGATCTTGCCTTTGGGATTTGGCC
AAGATGGGTGTGATTAGCGAAGAAAAAGTATGCACTTTCAATGTGCCCGC
ATATTTTCCATACGTGGAGGAGCTGGAATCACTTA
back to top