CF503857

Overview
NameCF503857
Unique NameCF503857
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length328
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig11134 contig Csv1_Contig11134:919..1246. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF503857 vs. ExPASy Swiss-Prot
Match: TBB6_GOSHI (Tubulin beta-6 chain OS=Gossypium hirsutum PE=2 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 4.095e-57
Identity = 100/107 (93.46%), Postives = 103/107 (96.26%), Query Frame = 3
Query:    6 MREILHIQGGQCGNQIGSKFWEVICDEHGVDPTGKYRGDGVEDLQLERINVYYNEASGGRYVPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGH 326
            MREILH+QGGQCGNQIGSKFWEVICDEHGVDPTGKY GDG  D+QLERI+VYYNEASGGRYVPRAVLMDLEPGTMDSIRSGP GQIFRPDNFVFGQSGAGNNWAKGH
Sbjct:    1 MREILHVQGGQCGNQIGSKFWEVICDEHGVDPTGKYNGDGSSDIQLERIDVYYNEASGGRYVPRAVLMDLEPGTMDSIRSGPIGQIFRPDNFVFGQSGAGNNWAKGH 107          
BLAST of CF503857 vs. ExPASy Swiss-Prot
Match: TBB1_ARATH (Tubulin beta-1 chain OS=Arabidopsis thaliana GN=TUBB1 PE=2 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 1.192e-56
Identity = 101/107 (94.39%), Postives = 103/107 (96.26%), Query Frame = 3
Query:    6 MREILHIQGGQCGNQIGSKFWEVICDEHGVDPTGKYRGDGVEDLQLERINVYYNEASGGRYVPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGH 326
            MREILH+QGGQCGNQIGSKFWEVICDEHGVDPTG+Y GD   DLQLERINVYYNEASGGRYVPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct:    1 MREILHVQGGQCGNQIGSKFWEVICDEHGVDPTGRYNGDSA-DLQLERINVYYNEASGGRYVPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGH 106          
BLAST of CF503857 vs. ExPASy Swiss-Prot
Match: TBB2_SOLTU (Tubulin beta-2 chain OS=Solanum tuberosum GN=TUBB2 PE=2 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 1.317e-55
Identity = 100/108 (92.59%), Postives = 103/108 (95.37%), Query Frame = 3
Query:    6 MREILHIQGGQCGNQIGSKFWEVICDEHGVDPTGKYRGDGVE-DLQLERINVYYNEASGGRYVPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGH 326
            MREILHIQGGQCGNQIGSKFWEVICDEHGVDPTG+Y+G   E DLQLERINVY+NEASGGRYVPRAVLMDLEPGTMDSIRSGPYGQIFRPDN VFGQSGAGNNWAKGH
Sbjct:    1 MREILHIQGGQCGNQIGSKFWEVICDEHGVDPTGRYKGTAAESDLQLERINVYFNEASGGRYVPRAVLMDLEPGTMDSIRSGPYGQIFRPDNLVFGQSGAGNNWAKGH 108          
BLAST of CF503857 vs. ExPASy Swiss-Prot
Match: TBB1_SOLTU (Tubulin beta-1 chain OS=Solanum tuberosum GN=TUBB1 PE=2 SV=1)

HSP 1 Score: 214.542 bits (545), Expect = 1.317e-55
Identity = 100/108 (92.59%), Postives = 103/108 (95.37%), Query Frame = 3
Query:    6 MREILHIQGGQCGNQIGSKFWEVICDEHGVDPTGKYRGDGVE-DLQLERINVYYNEASGGRYVPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGH 326
            MREILHIQGGQCGNQIGSKFWEVICDEHGVDPTG+Y+G   E DLQLERINVY+NEASGGRYVPRAVLMDLEPGTMDSIRSGPYGQIFRPDN VFGQSGAGNNWAKGH
Sbjct:    1 MREILHIQGGQCGNQIGSKFWEVICDEHGVDPTGRYKGTAAESDLQLERINVYFNEASGGRYVPRAVLMDLEPGTMDSIRSGPYGQIFRPDNLVFGQSGAGNNWAKGH 108          
BLAST of CF503857 vs. ExPASy Swiss-Prot
Match: TBB3_ORYSJ (Tubulin beta-3 chain OS=Oryza sativa subsp. japonica GN=TUBB3 PE=2 SV=2)

HSP 1 Score: 213.386 bits (542), Expect = 2.935e-55
Identity = 99/107 (92.52%), Postives = 102/107 (95.33%), Query Frame = 3
Query:    6 MREILHIQGGQCGNQIGSKFWEVICDEHGVDPTGKYRGDGVEDLQLERINVYYNEASGGRYVPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGH 326
            MREILHIQGGQCGNQIG+KFWEVICDEHG+D TGKY GD   DLQLERINVYYNEASGGRYVPRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct:    1 MREILHIQGGQCGNQIGAKFWEVICDEHGIDHTGKYSGDS--DLQLERINVYYNEASGGRYVPRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGH 105          
BLAST of CF503857 vs. ExPASy Swiss-Prot
Match: TBB5_GOSHI (Tubulin beta-5 chain OS=Gossypium hirsutum PE=2 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 5.006e-55
Identity = 99/107 (92.52%), Postives = 102/107 (95.33%), Query Frame = 3
Query:    6 MREILHIQGGQCGNQIGSKFWEVICDEHGVDPTGKYRGDGVEDLQLERINVYYNEASGGRYVPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGH 326
            MREILHIQGGQCGNQIG+KFWEVICDEHGVD TGKY GD   DLQLERINVYYNEASGGRYVPRAVLMDLEPGTMDS+RSGP+GQIFRPDNFVFGQSGAGNNWAKGH
Sbjct:    1 MREILHIQGGQCGNQIGAKFWEVICDEHGVDNTGKYNGDS--DLQLERINVYYNEASGGRYVPRAVLMDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105          
BLAST of CF503857 vs. ExPASy Swiss-Prot
Match: TBB5_ARATH (Tubulin beta-5 chain OS=Arabidopsis thaliana GN=TUBB5 PE=2 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 5.006e-55
Identity = 99/107 (92.52%), Postives = 102/107 (95.33%), Query Frame = 3
Query:    6 MREILHIQGGQCGNQIGSKFWEVICDEHGVDPTGKYRGDGVEDLQLERINVYYNEASGGRYVPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGH 326
            MREILHIQGGQCGNQIGSKFWEVICDEHG+D TG+Y GD   DLQLERINVYYNEASGGRYVPRAVLMDLEPGTMDSIRSGP+GQIFRPDNFVFGQSGAGNNWAKGH
Sbjct:    1 MREILHIQGGQCGNQIGSKFWEVICDEHGIDSTGRYSGD-TADLQLERINVYYNEASGGRYVPRAVLMDLEPGTMDSIRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 106          
BLAST of CF503857 vs. ExPASy Swiss-Prot
Match: TBB3_WHEAT (Tubulin beta-3 chain OS=Triticum aestivum GN=TUBB3 PE=2 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 8.540e-55
Identity = 98/107 (91.59%), Postives = 102/107 (95.33%), Query Frame = 3
Query:    6 MREILHIQGGQCGNQIGSKFWEVICDEHGVDPTGKYRGDGVEDLQLERINVYYNEASGGRYVPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGH 326
            MREILHIQGGQCGNQIG+KFWEVICDEHG+D TGKY GD   DLQLERINVYYNEASGGR+VPRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct:    1 MREILHIQGGQCGNQIGAKFWEVICDEHGIDQTGKYAGDS--DLQLERINVYYNEASGGRFVPRAVLMDLEPGTMDSLRSGPYGQIFRPDNFVFGQSGAGNNWAKGH 105          
BLAST of CF503857 vs. ExPASy Swiss-Prot
Match: TBB3_SOYBN (Tubulin beta chain (Fragment) OS=Glycine max GN=TUBB PE=2 SV=2)

HSP 1 Score: 211.846 bits (538), Expect = 8.540e-55
Identity = 98/107 (91.59%), Postives = 102/107 (95.33%), Query Frame = 3
Query:    6 MREILHIQGGQCGNQIGSKFWEVICDEHGVDPTGKYRGDGVEDLQLERINVYYNEASGGRYVPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGH 326
            MREILHIQGGQCGNQIG+KFWEVICDEHG+D TGKY GD   +LQLERINVYYNEASGGRYVPRAVLMDLEPGTMDS+RSGPYGQIFRPDNFVFGQSGAGNNWAKGH
Sbjct:    1 MREILHIQGGQCGNQIGAKFWEVICDEHGIDHTGKYSGDS--ELQLERINVYYNEASGGRYVPRAVLMDLEPGTMDSVRSGPYGQIFRPDNFVFGQSGAGNNWAKGH 105          
BLAST of CF503857 vs. ExPASy Swiss-Prot
Match: TBB7_ORYSJ (Tubulin beta-7 chain OS=Oryza sativa subsp. japonica GN=TUBB7 PE=2 SV=2)

HSP 1 Score: 211.46 bits (537), Expect = 1.115e-54
Identity = 98/107 (91.59%), Postives = 102/107 (95.33%), Query Frame = 3
Query:    6 MREILHIQGGQCGNQIGSKFWEVICDEHGVDPTGKYRGDGVEDLQLERINVYYNEASGGRYVPRAVLMDLEPGTMDSIRSGPYGQIFRPDNFVFGQSGAGNNWAKGH 326
            MREILHIQGGQCGNQIG+KFWEVICDEHGVD TG+Y GD   DLQLERINVYYNEASGGRYVPRAVLMDLEPGTMDS+RSGP+GQIFRPDNFVFGQSGAGNNWAKGH
Sbjct:    1 MREILHIQGGQCGNQIGAKFWEVICDEHGVDATGRYAGDS--DLQLERINVYYNEASGGRYVPRAVLMDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGH 105          
The following BLAST results are available for this feature:
BLAST of CF503857 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 402
Match NameE-valueIdentityDescription
TBB6_GOSHI4.095e-5793.46Tubulin beta-6 chain OS=Gossypium hirsutum PE=2 SV... [more]
TBB1_ARATH1.192e-5694.39Tubulin beta-1 chain OS=Arabidopsis thaliana GN=TU... [more]
TBB2_SOLTU1.317e-5592.59Tubulin beta-2 chain OS=Solanum tuberosum GN=TUBB2... [more]
TBB1_SOLTU1.317e-5592.59Tubulin beta-1 chain OS=Solanum tuberosum GN=TUBB1... [more]
TBB3_ORYSJ2.935e-5592.52Tubulin beta-3 chain OS=Oryza sativa subsp. japoni... [more]
TBB5_GOSHI5.006e-5592.52Tubulin beta-5 chain OS=Gossypium hirsutum PE=2 SV... [more]
TBB5_ARATH5.006e-5592.52Tubulin beta-5 chain OS=Arabidopsis thaliana GN=TU... [more]
TBB3_WHEAT8.540e-5591.59Tubulin beta-3 chain OS=Triticum aestivum GN=TUBB3... [more]
TBB3_SOYBN8.540e-5591.59Tubulin beta chain (Fragment) OS=Glycine max GN=TU... [more]
TBB7_ORYSJ1.115e-5491.59Tubulin beta-7 chain OS=Oryza sativa subsp. japoni... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-344 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-10_E10 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF503857 ID=CF503857|Name=CF503857|organism=Citrus sinensis|type=EST|length=328bp
GATAAATGAGAGAGATCTTGCACATTCAAGGAGGCCAATGCGGCAACCAA
ATCGGCTCCAAATTCTGGGAAGTCATTTGCGACGAGCATGGCGTGGACCC
CACGGGGAAGTATAGAGGTGACGGCGTTGAGGATCTTCAACTGGAGCGAA
TCAATGTCTATTACAACGAAGCTTCCGGTGGAAGGTACGTGCCTCGAGCT
GTTCTCATGGATCTTGAACCCGGTACCATGGATAGTATCAGATCCGGCCC
GTACGGCCAGATCTTTCGACCTGATAACTTCGTTTTTGGACAATCCGGTG
CGGGCAATAACTGGGCCAAAGGTCATTA
back to top