CF503911

Overview
NameCF503911
Unique NameCF503911
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length675
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CF503911_ssr87 microsatellite CF503911_ssr87:87..98. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig535 contig Csv1_Contig535:215..896. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF503911 vs. ExPASy Swiss-Prot
Match: IAA8_ARATH (Auxin-responsive protein IAA8 OS=Arabidopsis thaliana GN=IAA8 PE=2 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 1.051e-23
Identity = 85/221 (38.46%), Postives = 113/221 (51.13%), Query Frame = 3
Query:   15 EHDYIGLSESSSVPRSSDKLXXXXXXXXXXXXXXXXXXKACLNFKETELRLGLPGSQSPGRKPSHGL-SLFGKDIEXXXXXXXXXXGYAAPSPLKSLVSGAKRGFSDALDGASRNWGLSINGKPDAELGKGAVLYSPRGGLDDKCKIVKEVDVLPLSPKPVQEKKNQVPALNENEPTSAPAAKAQVVGWPPIRSFRKNTMASNLVKNNDAAEGKSGSGCLY 674
            E +Y+GLS+ SSV  S+                     K+ LNFK TELRLGLP SQSP R+   GL S    D +            +A +  K++VSG KRGF+D  D  S   G+  + +P   +    ++ SP+         VK+V       K +QE+++       N    APAAKAQVVGWPPIRS+RKNTMAS+  KN D  +GK G G L+
Sbjct:   21 ERNYLGLSDCSSVDSST---------------IPNVVGKSNLNFKATELRLGLPESQSPERETDFGLLSPRTPDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWDEFS---GVKGSVRPGGGIN---MMLSPK---------VKDVS------KSIQEERSHAKGGLNN----APAAKAQVVGWPPIRSYRKNTMASSTSKNTDEVDGKPGLGVLF 201          
BLAST of CF503911 vs. ExPASy Swiss-Prot
Match: IAA9_ARATH (Auxin-responsive protein IAA9 OS=Arabidopsis thaliana GN=IAA9 PE=1 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.088e-20
Identity = 74/220 (33.64%), Postives = 103/220 (46.82%), Query Frame = 3
Query:   15 EHDYIGLSESSSVPRSSDKLXXXXXXXXXXXXXXXXXXKACLNFKETELRLGLPGSQSPGRKPSHGLSLFGKDIEXXXXXXXXXXGYAAPSPLKSLVSGAKRGFSDALDGASRNWGLSINGKPDAELGKGAVLYSPRGGLDDKCKIVKEVDVLPLSPKPVQEKKNQVPALNENEPTSAPAAKAQVVGWPPIRSFRKNTMASNLVKNNDAAEGKSGSGCLY 674
            EH+Y+GLS+ SSV  S+                     KA ++ K TEL LGLPGSQSP R     L    K  E               S  K+  SG KRGFSD +D  +                K +V Y+ +  +  +    + V     + K V +   +  +   N  +S PAAKAQ+VGWPP+RS+RKNT+A+   KN+D  +G+ GSG L+
Sbjct:   33 EHNYLGLSDCSSVGSST-------------LSPLAEDDKATISLKATELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSDTMDQFAE--------------AKSSV-YTEKNWMFPEAAATQSV-----TKKDVPQNIPKGQSSTTNNSSSPPAAKAQIVGWPPVRSYRKNTLATT-CKNSDEVDGRPGSGALF 218          
BLAST of CF503911 vs. ExPASy Swiss-Prot
Match: IAA27_ARATH (Auxin-responsive protein IAA27 OS=Arabidopsis thaliana GN=IAA27 PE=2 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 9.208e-20
Identity = 86/230 (37.39%), Postives = 108/230 (46.96%), Query Frame = 3
Query:   15 EHDYIGLSESSSVPRS--SDKLXXXXXXXXXXXXXXXXXXKACLNFKETELRLGLPGSQSPGRKPSHGLSLFGKDIEXXXXXXXXXXGYAAPSPLKSLVSGAKRGFSDALDGASRNWGLSINGKPDAELGKGAVLYSPRGGLDDKCKIVKEVDVLPLSPKPVQEKKNQVPALNENEPTSAPAAKAQVVGWPPIRSFRKNTMASNLVK---NN---DAAEGKSG--SGCLY 674
            EHDYIGLSE  ++  +  SDK                      LNFK TELRLGLPGS+SP R  S  L+L                     +     VSGAKR FSDA++ +++ W  S    P +    G V      G   +  +VK+        K     K  VP   +    +APA+KAQVVGWPPIRSFRKN+MAS+  +   NN   + AE KSG    CLY
Sbjct:    8 EHDYIGLSEFPTMEATTMSDKTKTRDNNNG-------------LNFKATELRLGLPGSESPERVDSRFLAL---------------------NKSSCPVSGAKRVFSDAINDSNK-WVFS----PGSTTATGDV----GSGSGPRTSVVKD-------GKSTTFTKPAVPVKEKKSSATAPASKAQVVGWPPIRSFRKNSMASSQSQKPGNNSETEEAEAKSGPEQPCLY 187          
BLAST of CF503911 vs. ExPASy Swiss-Prot
Match: IAA21_ORYSJ (Auxin-responsive protein IAA21 OS=Oryza sativa subsp. japonica GN=IAA21 PE=2 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.507e-11
Identity = 64/179 (35.75%), Postives = 78/179 (43.58%), Query Frame = 3
Query:  153 TELRLGLPGSQSPGRKPSHGLSLFGKDIEXXXXXXXXXXGYAAPSPLKSL-VSGAKRGFSDALDGASRNWGLSINGKPDAELGKGAVLYSPRGGLDDKCKIVKEVDVLPLSPKPVQEKKNQVPALNENEPTSAPAAKAQVVGWPPIRSFRKNTMASN--LVKNNDAAEGKS--GSGCLY 674
            TELRLGLPG+       S G    G D              AAP  L+ L   GAKRGF+DA+ G           + +A  GK A                        +    +E++       E +   APAAKAQVVGWPPIRS+RKNTMA +   +K  D  E K    SGCLY
Sbjct:   22 TELRLGLPGTAEEAE--SEGGGGGGTD--------------AAPLTLELLPKGGAKRGFADAIVGG------PAGQRREAAGGKAAA-----------------------AAAEAEEEE-------EKKKAQAPAAKAQVVGWPPIRSYRKNTMAMSQPALKGKDDGEAKQAPASGCLY 148          
The following BLAST results are available for this feature:
BLAST of CF503911 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 4
Match NameE-valueIdentityDescription
IAA8_ARATH1.051e-2338.46Auxin-responsive protein IAA8 OS=Arabidopsis thali... [more]
IAA9_ARATH1.088e-2033.64Auxin-responsive protein IAA9 OS=Arabidopsis thali... [more]
IAA27_ARATH9.208e-2037.39Auxin-responsive protein IAA27 OS=Arabidopsis thal... [more]
IAA21_ORYSJ3.507e-1135.75Auxin-responsive protein IAA21 OS=Oryza sativa sub... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-399 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-11_B10 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF503911 ID=CF503911; Name=CF503911; organism=Citrus sinensis; type=EST; length=675bp
CTACTACACCACTTGAGCATGATTACATAGGCCTATCAGAGTCTTCTTCA
GTGCCAAGAAGCTCTGACAAGCTTTCCTATTCTTCCTCTTCTTCTTCTTG
TACTGAAGAAAACTACACGAGTAGCAACAAAGCATGTCTCAATTTCAAGG
AGACTGAGCTGAGGCTTGGCTTACCAGGGTCTCAGTCTCCAGGGAGGAAA
CCATCACATGGGCTGTCTCTTTTTGGCAAAGATATTGAGAACAACAACAG
CAACAGCAACAACACTAACGGGTATGCTGCTCCTAGCCCTTTGAAGAGCT
TAGTCTCTGGTGCTAAAAGGGGTTTCTCTGATGCCCTTGATGGAGCTTCT
CGCAACTGGGGTTTGTCCATTAATGGTAAACCTGATGCCGAGTTGGGTAA
AGGTGCTGTCTTGTATTCTCCTAGAGGTGGGTTAGATGATAAGTGCAAGA
TCGTGAAGGAAGTTGATGTCTTGCCTCTGTCTCCTAAGCCAGTTCAAGAG
AAGAAGAATCAAGTCCCTGCTTTAAATGAAAATGAACCAACTAGTGCCCC
TGCTGCAAAGGCACAGGTGGTGGGATGGCCACCAATTCGATCTTTCCGGA
AGAACACCATGGCCTCTAATTTGGTAAAGAACAATGATGCCGCTGAAGGC
AAGTCGGGATCTGGATGTCTCTATG
back to top