CF503939

Overview
NameCF503939
Unique NameCF503939
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length355
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF503939 vs. ExPASy Swiss-Prot
Match: C3H32_ARATH (Zinc finger CCCH domain-containing protein 32 OS=Arabidopsis thaliana GN=At2g47850 PE=2 SV=2)

HSP 1 Score: 150.599 bits (379), Expect = 1.272e-43
Identity = 65/87 (74.71%), Postives = 72/87 (82.76%), Query Frame = 2
Query:   95 GDRCRYNHPRNXXXXXXXXXXTGDYPDRPGEPICQFYLKTGTCKFGASCKFHHPKHSGGSMSHVPLNIYGYPLRPGEKECSYYLKTG 355
            G+RCRYNHPR+          TG YP+R GEP CQFYLKTGTCKFGASCKFHHPK++GGSMSHVPLNIYGYP+R G+ ECSYYLKTG
Sbjct:   63 GNRCRYNHPRDRASVEATVRATGQYPERFGEPPCQFYLKTGTCKFGASCKFHHPKNAGGSMSHVPLNIYGYPVREGDNECSYYLKTG 149          

HSP 2 Score: 47.3654 bits (111), Expect = 1.272e-43
Identity = 17/24 (70.83%), Postives = 21/24 (87.50%), Query Frame = 1
Query:   22 NESYPQRHGVPDCVFYMRTGVCGY 93
            ++SYP+R G PDC +YMRTGVCGY
Sbjct:   39 SDSYPERPGAPDCAYYMRTGVCGY 62          

HSP 3 Score: 85.1149 bits (209), Expect = 1.203e-16
Identity = 34/63 (53.97%), Postives = 46/63 (73.02%), Query Frame = 2
Query:  167 YPDRPGEPICQFYLKTGTCKFGASCKFHHPKHSGGSMSHVPLNIYGYPLRPGEKECSYYLKTG 355
            +P+RPGEP CQ+YLKTG CKFG SCKFHHP+      ++  L+  G PLRPG + C++Y++ G
Sbjct:  286 FPERPGEPECQYYLKTGDCKFGTSCKFHHPRDRVPPRANCVLSPIGLPLRPGVQRCTFYVQNG 348          
BLAST of CF503939 vs. ExPASy Swiss-Prot
Match: C3H58_ARATH (Zinc finger CCCH domain-containing protein 58 OS=Arabidopsis thaliana GN=At5g18550 PE=2 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 1.761e-32
Identity = 50/90 (55.56%), Postives = 67/90 (74.44%), Query Frame = 2
Query:   95 GDRCRYNHPRNXXXXXXXXXX-TGDYPDRPGEPICQFYLKTGTCKFGASCKFHHPKHSGG--SMSHVPLNIYGYPLRPGEKECSYYLKTG 355
            G RCR+NHPRN            G++P+R G+P+CQ +++TGTCKFGASCK+HHP+  GG  S++ V LN  G+PLRPGEKECSY+++TG
Sbjct:   69 GSRCRFNHPRNRAPVLGGLRTEAGEFPERMGQPVCQHFMRTGTCKFGASCKYHHPRQGGGGDSVTPVSLNYMGFPLRPGEKECSYFMRTG 158          

HSP 2 Score: 41.9726 bits (97), Expect = 1.761e-32
Identity = 14/23 (60.87%), Postives = 20/23 (86.96%), Query Frame = 1
Query:   25 ESYPQRHGVPDCVFYMRTGVCGY 93
            E++P+R   PDC++Y+RTGVCGY
Sbjct:   46 ETFPERPDEPDCIYYLRTGVCGY 68          

HSP 3 Score: 68.5514 bits (166), Expect = 1.165e-11
Identity = 28/67 (41.79%), Postives = 43/67 (64.18%), Query Frame = 2
Query:  167 YPDRPGEPICQFYLKTGTCKFGASCKFHHPKHS----GGSMSHVPLNIYGYPLRPGEKECSYYLKTG 355
            +P RP +P CQ++++TG CKFG SC+FHHP  +      ++SH+     G PLRPG   C+++ + G
Sbjct:  297 FPQRPEQPECQYFMRTGDCKFGTSCRFHHPMEAASPEASTLSHI-----GLPLRPGAVPCTHFAQHG 358          
BLAST of CF503939 vs. ExPASy Swiss-Prot
Match: C3H34_ARATH (Zinc finger CCCH domain-containing protein 34 OS=Arabidopsis thaliana GN=At3g06410 PE=2 SV=2)

HSP 1 Score: 114.775 bits (286), Expect = 3.890e-32
Identity = 51/90 (56.67%), Postives = 64/90 (71.11%), Query Frame = 2
Query:   95 GDRCRYNHPRNXXXXXXXXXX-TGDYPDRPGEPICQFYLKTGTCKFGASCKFHHPKH--SGGSMSHVPLNIYGYPLRPGEKECSYYLKTG 355
            G RCR+NHPR+            G  P+R G P+CQ +++TGTCKFGASCK+HHP+    GGS++ V L+  GYPLRPGEKECSYYL+TG
Sbjct:   72 GSRCRFNHPRDRGAVIGGVRGEAGALPERMGHPVCQHFMRTGTCKFGASCKYHHPRQGGGGGSVAPVSLSYLGYPLRPGEKECSYYLRTG 161          

HSP 2 Score: 44.669 bits (104), Expect = 3.890e-32
Identity = 16/23 (69.57%), Postives = 20/23 (86.96%), Query Frame = 1
Query:   25 ESYPQRHGVPDCVFYMRTGVCGY 93
            ESYP+R   PDC++Y+RTGVCGY
Sbjct:   49 ESYPERPDEPDCIYYLRTGVCGY 71          

HSP 3 Score: 72.4034 bits (176), Expect = 8.067e-13
Identity = 26/64 (40.62%), Postives = 45/64 (70.31%), Query Frame = 2
Query:  164 DYPDRPGEPICQFYLKTGTCKFGASCKFHHPKHSGGSMSHVPLNIYGYPLRPGEKECSYYLKTG 355
            ++P RP +P CQ++++TG CKFG+SC++HHP  +    + + L+  G PLRPG  +C+++ + G
Sbjct:  303 EFPQRPDQPECQYFMRTGDCKFGSSCRYHHPVDAVPPKTGIVLSSIGLPLRPGVAQCTHFAQHG 366          
BLAST of CF503939 vs. ExPASy Swiss-Prot
Match: C3H12_ORYSJ (Zinc finger CCCH domain-containing protein 12 OS=Oryza sativa subsp. japonica GN=Os01g0917400 PE=2 SV=2)

HSP 1 Score: 119.783 bits (299), Expect = 1.899e-31
Identity = 50/87 (57.47%), Postives = 60/87 (68.97%), Query Frame = 2
Query:   95 GDRCRYNHPRNXXXXXXXXXXTGDYPDRPGEPICQFYLKTGTCKFGASCKFHHPKHSGGSMSHVPLNIYGYPLRPGEKECSYYLKTG 355
            G  CR+NHP++           G+YP+R G+P CQ+YLKTGTCKFG +CKFHHP+   G    V LN  GYPLRP EKEC+YYLKTG
Sbjct:   98 GMSCRFNHPQDRNLAIASARMKGEYPERMGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLRPSEKECAYYLKTG 184          

HSP 2 Score: 37.3502 bits (85), Expect = 1.899e-31
Identity = 12/21 (57.14%), Postives = 17/21 (80.95%), Query Frame = 1
Query:   31 YPQRHGVPDCVFYMRTGVCGY 93
            YP+R G PDC +Y+RTG+C +
Sbjct:   77 YPERSGEPDCTYYLRTGLCRF 97          

HSP 3 Score: 77.7962 bits (190), Expect = 1.920e-14
Identity = 32/63 (50.79%), Postives = 42/63 (66.67%), Query Frame = 2
Query:  167 YPDRPGEPICQFYLKTGTCKFGASCKFHHPKHSGGSMSHVPLNIYGYPLRPGEKECSYYLKTG 355
            +P+RP +P CQ+Y+KTG CKFGA CKFHHP+          L+  G PLRPGE+ C +Y + G
Sbjct:  329 FPERPDQPECQYYMKTGDCKFGAVCKFHHPRVRSMPTPDCVLSPVGLPLRPGEELCKFYSRYG 391          

HSP 4 Score: 60.8474 bits (146), Expect = 7.879e-13
Identity = 27/61 (44.26%), Postives = 35/61 (57.38%), Query Frame = 2
Query:   80 GSVDTGDRCRYNHPRNXXXXXXXXXX-TGDYPDRPGEPICQFYLKTGTCKFGASCKFHHPK 259
            G+   G  C+++HPR            T  YP RP E  C +YLKTG CK+G +CKFHHP+
Sbjct:  138 GTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLRPSEKECAYYLKTGQCKYGNTCKFHHPE 198          

HSP 5 Score: 33.4982 bits (75), Expect = 7.879e-13
Identity = 10/26 (38.46%), Postives = 18/26 (69.23%), Query Frame = 1
Query:   16 KVNESYPQRHGVPDCVFYMRTGVCGY 93
            ++   YP+R G P+C +Y++TG C +
Sbjct:  117 RMKGEYPERMGQPECQYYLKTGTCKF 142          
BLAST of CF503939 vs. ExPASy Swiss-Prot
Match: C3H66_ORYSJ (Zinc finger CCCH domain-containing protein 66 OS=Oryza sativa subsp. japonica GN=Os12g0405100 PE=2 SV=1)

HSP 1 Score: 117.472 bits (293), Expect = 2.471e-31
Identity = 48/87 (55.17%), Postives = 60/87 (68.97%), Query Frame = 2
Query:   95 GDRCRYNHPRNXXXXXXXXXXTGDYPDRPGEPICQFYLKTGTCKFGASCKFHHPKHSGGSMSHVPLNIYGYPLRPGEKECSYYLKTG 355
            G  C++NHP N           G+YP R G+P CQ+YLKTGTCKFGA+CKFHHP+      + V LN+ GYP+RP EKEC+YYL+TG
Sbjct:   84 GMTCKFNHPPNRKLAVAAARMNGEYPYRVGQPECQYYLKTGTCKFGATCKFHHPREKAALANRVQLNVLGYPMRPNEKECAYYLRTG 170          

HSP 2 Score: 39.2762 bits (90), Expect = 2.471e-31
Identity = 18/36 (50.00%), Postives = 22/36 (61.11%), Query Frame = 1
Query:    1 WQSDLKVNES-----YPQRHGVPDCVFYMRTGVCGY 93
            WQ  L   ES     YP+R G PDC +YMRTG+C +
Sbjct:   48 WQMTLGGGESMESTPYPERIGEPDCSYYMRTGLCRF 83          

HSP 3 Score: 83.1889 bits (204), Expect = 4.570e-16
Identity = 35/63 (55.56%), Postives = 43/63 (68.25%), Query Frame = 2
Query:  167 YPDRPGEPICQFYLKTGTCKFGASCKFHHPKHSGGSMSHVPLNIYGYPLRPGEKECSYYLKTG 355
            +P+RP +P CQFY+KTG CKFGA CKFHHPK       +  LN  G PLRPGE  C++Y + G
Sbjct:  315 FPERPDQPECQFYMKTGDCKFGAVCKFHHPKERLVPAPNCALNSLGLPLRPGEPVCTFYSRYG 377          

HSP 4 Score: 58.9214 bits (141), Expect = 1.724e-12
Identity = 26/63 (41.27%), Postives = 35/63 (55.56%), Query Frame = 2
Query:   80 GSVDTGDRCRYNHPRNXXXXXXXXXXTG-DYPDRPGEPICQFYLKTGTCKFGASCKFHHPKHS 265
            G+   G  C+++HPR               YP RP E  C +YL+TG CKF ++CKFHHP+ S
Sbjct:  124 GTCKFGATCKFHHPREKAALANRVQLNVLGYPMRPNEKECAYYLRTGQCKFASTCKFHHPQPS 186          

HSP 5 Score: 34.2686 bits (77), Expect = 1.724e-12
Identity = 11/26 (42.31%), Postives = 18/26 (69.23%), Query Frame = 1
Query:   16 KVNESYPQRHGVPDCVFYMRTGVCGY 93
            ++N  YP R G P+C +Y++TG C +
Sbjct:  103 RMNGEYPYRVGQPECQYYLKTGTCKF 128          
BLAST of CF503939 vs. ExPASy Swiss-Prot
Match: C3H57_ARATH (Zinc finger CCCH domain-containing protein 57 OS=Arabidopsis thaliana GN=ZFN3 PE=2 SV=2)

HSP 1 Score: 110.538 bits (275), Expect = 1.573e-30
Identity = 44/87 (50.57%), Postives = 58/87 (66.67%), Query Frame = 2
Query:   95 GDRCRYNHPRNXXXXXXXXXXTGDYPDRPGEPICQFYLKTGTCKFGASCKFHHPKHSGGSMSHVPLNIYGYPLRPGEKECSYYLKTG 355
            G  CR+NHP +           G+YP+R G+P C+FYLKTGTCKFG +CKFHHP++  G    V +N+  YPLRP E +CSY+L+ G
Sbjct:   60 GSTCRFNHPHDRKLVIATARIKGEYPERIGQPECEFYLKTGTCKFGVTCKFHHPRNKAGIDGSVSVNVLSYPLRPNEDDCSYFLRIG 146          

HSP 2 Score: 43.5134 bits (101), Expect = 1.573e-30
Identity = 18/37 (48.65%), Postives = 25/37 (67.57%), Query Frame = 1
Query:    1 WQSDLK------VNESYPQRHGVPDCVFYMRTGVCGY 93
            WQ +L       V+ SYP+RHG PDC +Y+RTG+C +
Sbjct:   23 WQMNLGSDDTMGVDGSYPERHGEPDCAYYIRTGLCRF 59          

HSP 3 Score: 78.9518 bits (193), Expect = 8.619e-15
Identity = 33/63 (52.38%), Postives = 41/63 (65.08%), Query Frame = 2
Query:  167 YPDRPGEPICQFYLKTGTCKFGASCKFHHPKHSGGSMSHVPLNIYGYPLRPGEKECSYYLKTG 355
            +P+RPG+P CQFY+KTG CKFG  CKFHHP+          L+  G PLRPGE  C +Y + G
Sbjct:  240 FPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQTPPPDCVLSSVGLPLRPGEPLCVFYSRYG 302          

HSP 4 Score: 69.707 bits (169), Expect = 5.229e-12
Identity = 31/66 (46.97%), Postives = 43/66 (65.15%), Query Frame = 2
Query:  161 GDYPDRPGEPICQFYLKTGTCKFGASCKFHHPKHSGGSMSHVPLNIYG-YPLRPGEKECSYYLKTG 355
            G YP+R GEP C +Y++TG C+FG++C+F+HP      +      I G YP R G+ EC +YLKTG
Sbjct:   37 GSYPERHGEPDCAYYIRTGLCRFGSTCRFNHPHDR--KLVIATARIKGEYPERIGQPECEFYLKTG 100          

HSP 5 Score: 58.151 bits (139), Expect = 8.309e-12
Identity = 27/63 (42.86%), Postives = 36/63 (57.14%), Query Frame = 2
Query:   71 CELGSVDTGDRCRYNHPRNXXXXXXXXXXTG-DYPDRPGEPICQFYLKTGTCKFGASCKFHHP 256
            C+ G+V     C+++HPR+          +    P RPGEP+C FY + G CKFG SCKF HP
Sbjct:  258 CKFGTV-----CKFHHPRDRQTPPPDCVLSSVGLPLRPGEPLCVFYSRYGICKFGPSCKFDHP 315          

HSP 6 Score: 55.8398 bits (133), Expect = 8.309e-12
Identity = 24/61 (39.34%), Postives = 34/61 (55.74%), Query Frame = 2
Query:   80 GSVDTGDRCRYNHPRNXXXXXXXXXXTG-DYPDRPGEPICQFYLKTGTCKFGASCKFHHPK 259
            G+   G  C+++HPRN              YP RP E  C ++L+ G CKFG +CKF+HP+
Sbjct:  100 GTCKFGVTCKFHHPRNKAGIDGSVSVNVLSYPLRPNEDDCSYFLRIGQCKFGGTCKFNHPQ 160          

HSP 7 Score: 35.039 bits (79), Expect = 8.309e-12
Identity = 11/26 (42.31%), Postives = 18/26 (69.23%), Query Frame = 1
Query:   16 KVNESYPQRHGVPDCVFYMRTGVCGY 93
            ++   YP+R G P+C FY++TG C +
Sbjct:   79 RIKGEYPERIGQPECEFYLKTGTCKF 104          

HSP 8 Score: 32.7278 bits (73), Expect = 8.309e-12
Identity = 11/21 (52.38%), Postives = 16/21 (76.19%), Query Frame = 1
Query:   31 YPQRHGVPDCVFYMRTGVCGY 93
            +P+R G P+C FYM+TG C +
Sbjct:  240 FPERPGQPECQFYMKTGDCKF 260          
BLAST of CF503939 vs. ExPASy Swiss-Prot
Match: C3H33_ARATH (Zinc finger CCCH domain-containing protein 33 OS=Arabidopsis thaliana GN=ZFN1 PE=1 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 2.665e-30
Identity = 45/87 (51.72%), Postives = 60/87 (68.97%), Query Frame = 2
Query:   95 GDRCRYNHPRNXXXXXXXXXXTGDYPDRPGEPICQFYLKTGTCKFGASCKFHHPKHSGGSMSHVPLNIYGYPLRPGEKECSYYLKTG 355
            G  CR+NHPR+           G+YP+R G+P C++YLKTGTCKFG +CKFHHP++  G    V LN+ GYPLR  E +C+Y+L+TG
Sbjct:   58 GSTCRFNHPRDRELVIATARMRGEYPERIGQPECEYYLKTGTCKFGVTCKFHHPRNKAGIAGRVSLNMLGYPLRSNEVDCAYFLRTG 144          

HSP 2 Score: 40.4318 bits (93), Expect = 2.665e-30
Identity = 17/36 (47.22%), Postives = 24/36 (66.67%), Query Frame = 1
Query:    1 WQSDLKVNE-----SYPQRHGVPDCVFYMRTGVCGY 93
            WQ +L  +E     SYP+R G PDC +Y+RTG+C +
Sbjct:   22 WQMNLSSDETMETGSYPERPGEPDCSYYIRTGLCRF 57          

HSP 3 Score: 79.7221 bits (195), Expect = 5.053e-15
Identity = 33/63 (52.38%), Postives = 41/63 (65.08%), Query Frame = 2
Query:  167 YPDRPGEPICQFYLKTGTCKFGASCKFHHPKHSGGSMSHVPLNIYGYPLRPGEKECSYYLKTG 355
            +P+RPG+P CQFY+KTG CKFG  CKFHHP+          L+  G PLRPGE  C +Y + G
Sbjct:  271 FPERPGQPECQFYMKTGDCKFGTVCKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFYTRYG 333          

HSP 4 Score: 58.5362 bits (140), Expect = 6.388e-12
Identity = 27/63 (42.86%), Postives = 36/63 (57.14%), Query Frame = 2
Query:   71 CELGSVDTGDRCRYNHPRNXXXXXXXXXXTG-DYPDRPGEPICQFYLKTGTCKFGASCKFHHP 256
            C+ G+V     C+++HPR+          +    P RPGEP+C FY + G CKFG SCKF HP
Sbjct:  289 CKFGTV-----CKFHHPRDRQAPPPDCLLSSIGLPLRPGEPLCVFYTRYGICKFGPSCKFDHP 346          

HSP 5 Score: 32.7278 bits (73), Expect = 6.388e-12
Identity = 11/21 (52.38%), Postives = 16/21 (76.19%), Query Frame = 1
Query:   31 YPQRHGVPDCVFYMRTGVCGY 93
            +P+R G P+C FYM+TG C +
Sbjct:  271 FPERPGQPECQFYMKTGDCKF 291          
BLAST of CF503939 vs. ExPASy Swiss-Prot
Match: ZFNL_PEA (Zinc finger CCCH domain-containing protein ZFN-like OS=Pisum sativum PE=2 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 3.468e-30
Identity = 49/87 (56.32%), Postives = 59/87 (67.82%), Query Frame = 2
Query:   95 GDRCRYNHPRNXXXXXXXXXXTGDYPDRPGEPICQFYLKTGTCKFGASCKFHHPKHSGGSMSHVPLNIYGYPLRPGEKECSYYLKTG 355
            G  CR+NHP N           G++P+R G+P CQ+YLKTGTCKFGA+C+FHHPK   G    V LNI GYPLRP E E +YYL+TG
Sbjct:   48 GATCRFNHPPNRKLAIATARMKGEFPERLGQPECQYYLKTGTCKFGATCRFHHPKDKAGVAGRVALNILGYPLRPNESERAYYLRTG 134          

HSP 2 Score: 38.1206 bits (87), Expect = 3.468e-30
Identity = 15/36 (41.67%), Postives = 24/36 (66.67%), Query Frame = 1
Query:    1 WQSDLKVNES-----YPQRHGVPDCVFYMRTGVCGY 93
            WQ +L+ +E+     YP+  G PDC +Y+RTG+C +
Sbjct:   12 WQMNLRSSETMESGPYPEHPGEPDCSYYIRTGLCRF 47          

HSP 3 Score: 76.2554 bits (186), Expect = 5.586e-14
Identity = 32/63 (50.79%), Postives = 41/63 (65.08%), Query Frame = 2
Query:  167 YPDRPGEPICQFYLKTGTCKFGASCKFHHPKHSGGSMSHVPLNIYGYPLRPGEKECSYYLKTG 355
            +P+RP +P CQFY+KTG CKFGA C+FHHP+          L+  G PLRPGE  C +Y + G
Sbjct:  275 FPERPDQPECQFYMKTGDCKFGAVCRFHHPRERQIPAPDCVLSPIGLPLRPGEPLCVFYSRYG 337          

HSP 4 Score: 58.151 bits (139), Expect = 3.964e-11
Identity = 28/63 (44.44%), Postives = 35/63 (55.56%), Query Frame = 2
Query:   71 CELGSVDTGDRCRYNHPRNXXXXXXXXXXTG-DYPDRPGEPICQFYLKTGTCKFGASCKFHHP 256
            C+ G+V     CR++HPR           +    P RPGEP+C FY + G CKFG SCKF HP
Sbjct:  293 CKFGAV-----CRFHHPRERQIPAPDCVLSPIGLPLRPGEPLCVFYSRYGICKFGPSCKFDHP 350          

HSP 5 Score: 30.4166 bits (67), Expect = 3.964e-11
Identity = 11/27 (40.74%), Postives = 18/27 (66.67%), Query Frame = 1
Query:   13 LKVNESYPQRHGVPDCVFYMRTGVCGY 93
            L+ +  +P+R   P+C FYM+TG C +
Sbjct:  269 LQRDNIFPERPDQPECQFYMKTGDCKF 295          
BLAST of CF503939 vs. ExPASy Swiss-Prot
Match: C3H63_ORYSJ (Zinc finger CCCH domain-containing protein 63 OS=Oryza sativa subsp. japonica GN=Os11g0472000 PE=2 SV=2)

HSP 1 Score: 115.546 bits (288), Expect = 4.511e-30
Identity = 48/87 (55.17%), Postives = 59/87 (67.82%), Query Frame = 2
Query:   95 GDRCRYNHPRNXXXXXXXXXXTGDYPDRPGEPICQFYLKTGTCKFGASCKFHHPKHSGGSMSHVPLNIYGYPLRPGEKECSYYLKTG 355
            G  C++NHP +           G+YP R G+P CQ+YLKTGTCKFGA+CKFHHP+      + V LN  GYPLRP EKEC+YYL+TG
Sbjct:   74 GMTCKFNHPADRKMAVAAARMKGEYPQRIGQPECQYYLKTGTCKFGATCKFHHPREKAAIATRVQLNALGYPLRPNEKECAYYLRTG 160          

HSP 2 Score: 36.965 bits (84), Expect = 4.511e-30
Identity = 13/21 (61.90%), Postives = 17/21 (80.95%), Query Frame = 1
Query:   31 YPQRHGVPDCVFYMRTGVCGY 93
            YP+R G PDC +YMRTG+C +
Sbjct:   53 YPERIGEPDCSYYMRTGLCRF 73          

HSP 3 Score: 80.4925 bits (197), Expect = 2.962e-15
Identity = 34/63 (53.97%), Postives = 43/63 (68.25%), Query Frame = 2
Query:  167 YPDRPGEPICQFYLKTGTCKFGASCKFHHPKHSGGSMSHVPLNIYGYPLRPGEKECSYYLKTG 355
            +P+RP +P CQFY+KTG CKFGA CKFHHPK       +  L+  G PLRPGE  C++Y + G
Sbjct:  306 FPERPDQPECQFYMKTGDCKFGAVCKFHHPKERIIPTPNCALSSLGLPLRPGEPICTFYSRYG 368          

HSP 4 Score: 62.003 bits (149), Expect = 2.131e-13
Identity = 27/63 (42.86%), Postives = 36/63 (57.14%), Query Frame = 2
Query:   80 GSVDTGDRCRYNHPRNXXXXXXXXXXTG-DYPDRPGEPICQFYLKTGTCKFGASCKFHHPKHS 265
            G+   G  C+++HPR               YP RP E  C +YL+TG CKFG++CKFHHP+ S
Sbjct:  114 GTCKFGATCKFHHPREKAAIATRVQLNALGYPLRPNEKECAYYLRTGQCKFGSTCKFHHPQPS 176          

HSP 5 Score: 34.2686 bits (77), Expect = 2.131e-13
Identity = 11/26 (42.31%), Postives = 18/26 (69.23%), Query Frame = 1
Query:   16 KVNESYPQRHGVPDCVFYMRTGVCGY 93
            ++   YPQR G P+C +Y++TG C +
Sbjct:   93 RMKGEYPQRIGQPECQYYLKTGTCKF 118          
BLAST of CF503939 vs. ExPASy Swiss-Prot
Match: C3H6_ORYSJ (Zinc finger CCCH domain-containing protein 6 OS=Oryza sativa subsp. japonica GN=Os01g0258700 PE=2 SV=2)

HSP 1 Score: 115.931 bits (289), Expect = 9.948e-30
Identity = 52/96 (54.17%), Postives = 65/96 (67.71%), Query Frame = 2
Query:   80 GSVDTGDRCRYNHPRNXXXXXXXXXXTG----DYPDRPGEPICQFYLKTGTCKFGASCKFHHPKHSGGSMSHVPLNIYGYPLRPGEKECSYYLKTG 355
            G+   GDRCRYNHPR+                DYP+R G+PIC++Y+KTGTCKFG +CK+HHPK  G  +  V LN  G+P+R GEKECSYY+KTG
Sbjct:   72 GACGFGDRCRYNHPRDRGGTEFGGGARNAAALDYPERAGQPICEYYMKTGTCKFGTNCKYHHPKQDGAVLP-VMLNNSGFPIRLGEKECSYYMKTG 166          

HSP 2 Score: 35.4242 bits (80), Expect = 9.948e-30
Identity = 12/20 (60.00%), Postives = 16/20 (80.00%), Query Frame = 1
Query:   34 PQRHGVPDCVFYMRTGVCGY 93
            P+R G  DCV+Y+RTG CG+
Sbjct:   57 PERPGEEDCVYYLRTGACGF 76          

HSP 3 Score: 81.6481 bits (200), Expect = 1.330e-15
Identity = 31/63 (49.21%), Postives = 44/63 (69.84%), Query Frame = 2
Query:  167 YPDRPGEPICQFYLKTGTCKFGASCKFHHPKHSGGSMSHVPLNIYGYPLRPGEKECSYYLKTG 355
            +P+RPG+P CQ+Y++TG CKFGA+CK+HHP+      S   +N    PLRPG + C+YY + G
Sbjct:  304 FPERPGQPDCQYYMRTGDCKFGATCKYHHPRELSAPKSGYMVNSLCLPLRPGAQPCAYYAQNG 366          

HSP 4 Score: 67.3958 bits (163), Expect = 2.595e-11
Identity = 27/67 (40.30%), Postives = 37/67 (55.22%), Query Frame = 2
Query:   80 GSVDTGDRCRYNHPRNXXXXXXXXXXTGDYPDRPGEPICQFYLKTGTCKFGASCKFHHPKHSGGSMS 280
            G+   G  C+Y+HP+              +P R GE  C +Y+KTG CKFG +CKFHHP+  G  M+
Sbjct:  121 GTCKFGTNCKYHHPKQDGAVLPVMLNNSGFPIRLGEKECSYYMKTGQCKFGTTCKFHHPEFGGVPMT 187          
The following BLAST results are available for this feature:
BLAST of CF503939 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 20
Match NameE-valueIdentityDescription
C3H32_ARATH1.272e-4374.71Zinc finger CCCH domain-containing protein 32 OS=A... [more]
C3H58_ARATH1.761e-3255.56Zinc finger CCCH domain-containing protein 58 OS=A... [more]
C3H34_ARATH3.890e-3256.67Zinc finger CCCH domain-containing protein 34 OS=A... [more]
C3H12_ORYSJ1.899e-3157.47Zinc finger CCCH domain-containing protein 12 OS=O... [more]
C3H66_ORYSJ2.471e-3155.17Zinc finger CCCH domain-containing protein 66 OS=O... [more]
C3H57_ARATH1.573e-3050.57Zinc finger CCCH domain-containing protein 57 OS=A... [more]
C3H33_ARATH2.665e-3051.72Zinc finger CCCH domain-containing protein 33 OS=A... [more]
ZFNL_PEA3.468e-3056.32Zinc finger CCCH domain-containing protein ZFN-lik... [more]
C3H63_ORYSJ4.511e-3055.17Zinc finger CCCH domain-containing protein 63 OS=O... [more]
C3H6_ORYSJ9.948e-3054.17Zinc finger CCCH domain-containing protein 6 OS=Or... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-427 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-11_E04 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF503939 ID=CF503939|Name=CF503939|organism=Citrus sinensis|type=EST|length=355bp
TGGCAATCGGACCTGAAGGTGAACGAATCTTACCCACAGCGCCATGGCGT
GCCGGACTGTGTGTTCTACATGCGAACTGGGGTCTGTGGATACCGGTGAC
AGGTGTCGTTACAATCACCCTCGCAATCGTGCTGCGGTTGAGGCTGCTGT
AAGGGCTACAGGAGATTATCCAGATCGACCAGGGGAACCCATATGTCAGT
TTTACTTGAAAACTGGAACCTGTAAATTTGGTGCATCCTGCAAATTCCAC
CACCCAAAACATTCAGGTGGATCCATGAGTCATGTTCCACTGAATATATA
TGGATACCCGCTACGACCGGGTGAGAAAGAATGCTCCTACTATTTGAAAA
CGGGG
back to top