CF504038

Overview
NameCF504038
Unique NameCF504038
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length192
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Homology
BLAST of CF504038 vs. ExPASy Swiss-Prot
Match: RLK90_ARATH (Probable inactive receptor kinase RLK902 OS=Arabidopsis thaliana GN=RLK902 PE=1 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 3.876e-23
Identity = 49/59 (83.05%), Postives = 58/59 (98.31%), Query Frame = 1
Query:    1 KRLKDVTVSEKEFREKMEVVGSMDHENLVPLRAYYYSRDEKLLVHDYMPMGSLSALLHG 177
            KRLKDVT++++EF+EK+EVVG+MDHENLVPLRAYYYS DEKLLV+D+MPMGSLSALLHG
Sbjct:  393 KRLKDVTMADREFKEKIEVVGAMDHENLVPLRAYYYSGDEKLLVYDFMPMGSLSALLHG 451          
BLAST of CF504038 vs. ExPASy Swiss-Prot
Match: Y1848_ARATH (Probable inactive receptor kinase At1g48480 OS=Arabidopsis thaliana GN=RKL1 PE=1 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 8.635e-23
Identity = 48/59 (81.36%), Postives = 58/59 (98.31%), Query Frame = 1
Query:    1 KRLKDVTVSEKEFREKMEVVGSMDHENLVPLRAYYYSRDEKLLVHDYMPMGSLSALLHG 177
            KRLKDV +++KEF+EK+E+VG+MDHENLVPLRAYY+SRDEKLLV+D+MPMGSLSALLHG
Sbjct:  399 KRLKDVMMADKEFKEKIELVGAMDHENLVPLRAYYFSRDEKLLVYDFMPMGSLSALLHG 457          
BLAST of CF504038 vs. ExPASy Swiss-Prot
Match: Y2267_ARATH (Probable inactive receptor kinase At2g26730 OS=Arabidopsis thaliana GN=At2g26730 PE=1 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 7.565e-19
Identity = 43/59 (72.88%), Postives = 50/59 (84.75%), Query Frame = 1
Query:    1 KRLKDVTVSEKEFREKMEVVGSMDHENLVPLRAYYYSRDEKLLVHDYMPMGSLSALLHG 177
            KRLKDV  S+KEF  +MEVVG + H N++PLRAYYYS+DEKLLV D+MP GSLSALLHG
Sbjct:  379 KRLKDVMASKKEFETQMEVVGKIKHPNVIPLRAYYYSKDEKLLVFDFMPTGSLSALLHG 437          
BLAST of CF504038 vs. ExPASy Swiss-Prot
Match: Y5659_ARATH (Probable inactive receptor kinase At5g16590 OS=Arabidopsis thaliana GN=At5g16590 PE=1 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 1.863e-17
Identity = 42/59 (71.19%), Postives = 50/59 (84.75%), Query Frame = 1
Query:    1 KRLKDVTVSEKEFREKMEVVGSMDHENLVPLRAYYYSRDEKLLVHDYMPMGSLSALLHG 177
            KRL+DV V EKEFREK++V+GS+ H NLV L AYY+SRDEKL+V +YM  GSLSALLHG
Sbjct:  371 KRLRDVVVPEKEFREKLQVLGSISHANLVTLIAYYFSRDEKLVVFEYMSRGSLSALLHG 429          
BLAST of CF504038 vs. ExPASy Swiss-Prot
Match: Y3288_ARATH (Probable inactive receptor kinase At3g02880 OS=Arabidopsis thaliana GN=At3g02880 PE=1 SV=1)

HSP 1 Score: 87.8113 bits (216), Expect = 1.863e-17
Identity = 42/59 (71.19%), Postives = 49/59 (83.05%), Query Frame = 1
Query:    1 KRLKDVTVSEKEFREKMEVVGSMDHENLVPLRAYYYSRDEKLLVHDYMPMGSLSALLHG 177
            KRL+DV V EKEFRE++ V+GSM H NLV L AYY+SRDEKLLV +YM  GSLSA+LHG
Sbjct:  373 KRLRDVVVPEKEFRERLHVLGSMSHANLVTLIAYYFSRDEKLLVFEYMSKGSLSAILHG 431          
BLAST of CF504038 vs. ExPASy Swiss-Prot
Match: Y4374_ARATH (Probable inactive receptor kinase At4g23740 OS=Arabidopsis thaliana GN=At4g23740 PE=1 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 1.744e-15
Identity = 33/59 (55.93%), Postives = 49/59 (83.05%), Query Frame = 1
Query:    1 KRLKDVTVSEKEFREKMEVVGSMDHENLVPLRAYYYSRDEKLLVHDYMPMGSLSALLHG 177
            KRLKDV   +++F ++ME++G + HEN+V L+AYYYS+DEKL+V+DY   GS+++LLHG
Sbjct:  365 KRLKDVAAGKRDFEQQMEIIGGIKHENVVELKAYYYSKDEKLMVYDYFSRGSVASLLHG 423          
BLAST of CF504038 vs. ExPASy Swiss-Prot
Match: Y5332_ARATH (Probable inactive receptor kinase At5g53320 OS=Arabidopsis thaliana GN=At5g53320 PE=1 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.928e-14
Identity = 33/60 (55.00%), Postives = 49/60 (81.67%), Query Frame = 1
Query:    1 KRLKDVTVSEKEFREKMEVVGSMDHENLVPLRAYYYSRDEKLLVHDYMPMGSLSALLHGE 180
            KR+K+V+V ++EF +++E +GS+ HEN+  LR Y+YS+DEKL+V+DY   GSLS LLHG+
Sbjct:  336 KRIKEVSVPQREFEQQIENIGSIKHENVATLRGYFYSKDEKLVVYDYYEHGSLSTLLHGQ 395          
BLAST of CF504038 vs. ExPASy Swiss-Prot
Match: Y5830_ARATH (Probable inactive receptor kinase At5g58300 OS=Arabidopsis thaliana GN=At5g58300 PE=1 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 5.610e-14
Identity = 34/60 (56.67%), Postives = 49/60 (81.67%), Query Frame = 1
Query:    1 KRLKDVTVSEKEFREKMEVVGSM-DHENLVPLRAYYYSRDEKLLVHDYMPMGSLSALLHG 177
            KRLK+V   ++EF ++ME++  + +H ++VPLRAYYYS+DEKL+V DY P G+LS+LLHG
Sbjct:  386 KRLKEVAAGKREFEQQMEIISRVGNHPSVVPLRAYYYSKDEKLMVCDYYPAGNLSSLLHG 445          
BLAST of CF504038 vs. ExPASy Swiss-Prot
Match: Y5516_ARATH (Probable receptor kinase At5g05160 OS=Arabidopsis thaliana GN=At5g05160 PE=1 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 5.610e-14
Identity = 35/60 (58.33%), Postives = 47/60 (78.33%), Query Frame = 1
Query:    1 KRLKDVTVSEKEFREKMEVVGSMD-HENLVPLRAYYYSRDEKLLVHDYMPMGSLSALLHG 177
            KRL++V  S+KEF ++ME+VG ++ H N VPL AYYYS+DEKLLV+ YM  GSL  ++HG
Sbjct:  375 KRLREVVASKKEFEQQMEIVGKINQHSNFVPLLAYYYSKDEKLLVYKYMTKGSLFGIMHG 434          
BLAST of CF504038 vs. ExPASy Swiss-Prot
Match: Y3868_ARATH (Probable inactive receptor kinase At3g08680 OS=Arabidopsis thaliana GN=At3g08680 PE=1 SV=1)

HSP 1 Score: 72.7886 bits (177), Expect = 6.203e-13
Identity = 34/62 (54.84%), Postives = 46/62 (74.19%), Query Frame = 1
Query:    1 KRLKDVTVSEKEFREKMEVVGSMD-HENLVPLRAYYYSRDEKLLVHDYMPMGSLSALLHGEH 183
            KRLK+V   ++EF ++ME VG +  H N+ PLRAYY+S+DEKLLV+DY   G+ S LLHG +
Sbjct:  369 KRLKEVAAGKREFEQQMEAVGRISPHVNVAPLRAYYFSKDEKLLVYDYYQGGNFSMLLHGNN 430          
The following BLAST results are available for this feature:
BLAST of CF504038 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 11
Match NameE-valueIdentityDescription
RLK90_ARATH3.876e-2383.05Probable inactive receptor kinase RLK902 OS=Arabid... [more]
Y1848_ARATH8.635e-2381.36Probable inactive receptor kinase At1g48480 OS=Ara... [more]
Y2267_ARATH7.565e-1972.88Probable inactive receptor kinase At2g26730 OS=Ara... [more]
Y5659_ARATH1.863e-1771.19Probable inactive receptor kinase At5g16590 OS=Ara... [more]
Y3288_ARATH1.863e-1771.19Probable inactive receptor kinase At3g02880 OS=Ara... [more]
Y4374_ARATH1.744e-1555.93Probable inactive receptor kinase At4g23740 OS=Ara... [more]
Y5332_ARATH1.928e-1455.00Probable inactive receptor kinase At5g53320 OS=Ara... [more]
Y5830_ARATH5.610e-1456.67Probable inactive receptor kinase At5g58300 OS=Ara... [more]
Y5516_ARATH5.610e-1458.33Probable receptor kinase At5g05160 OS=Arabidopsis ... [more]
Y3868_ARATH6.203e-1354.84Probable inactive receptor kinase At3g08680 OS=Ara... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-526 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-12_F08 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF504038 ID=CF504038|Name=CF504038|organism=Citrus sinensis|type=EST|length=192bp
AAGAGGTTGAAGGATGTGACGGTGTCGGAGAAGGAATTTAGGGAGAAGAT
GGAGGTGGTGGGATCTATGGATCATGAGAATTTGGTCCCATTGCGGGCTT
ATTATTACAGCAGAGATGAAAAGCTTCTTGTTCATGATTACATGCCCATG
GGAAGCTTATCTGCACTTTTGCATGGTGAGCACCTTTATATC
back to top