CF504042

Overview
NameCF504042
Unique NameCF504042
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length447
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9884 contig Csv1_Contig9884:15..461. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF504042 vs. ExPASy Swiss-Prot
Match: CB24_TOBAC (Chlorophyll a-b binding protein 40, chloroplastic OS=Nicotiana tabacum GN=CAB40 PE=2 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 3.668e-57
Identity = 102/120 (85.00%), Postives = 110/120 (91.67%), Query Frame = 3
Query:   93 FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW 446
            F GKAV L+PS +E++  G+++MRKT SK+  VSSGSPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW
Sbjct:   13 FAGKAVKLSPSSSEITGNGKVTMRKTASKAKTVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW 132          
BLAST of CF504042 vs. ExPASy Swiss-Prot
Match: CB21_TOBAC (Chlorophyll a-b binding protein 16, chloroplastic OS=Nicotiana tabacum GN=CAB16 PE=2 SV=1)

HSP 1 Score: 219.55 bits (558), Expect = 4.791e-57
Identity = 102/120 (85.00%), Postives = 110/120 (91.67%), Query Frame = 3
Query:   93 FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW 446
            F GKAV L+PS +E++  G+++MRKT SK+  VSSGSPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW
Sbjct:   12 FAGKAVKLSPSSSEVTGNGKVTMRKTASKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW 131          
BLAST of CF504042 vs. ExPASy Swiss-Prot
Match: CB2G_SOLLC (Chlorophyll a-b binding protein 3C, chloroplastic OS=Solanum lycopersicum GN=CAB3C PE=3 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 1.067e-56
Identity = 101/120 (84.17%), Postives = 109/120 (90.83%), Query Frame = 3
Query:   93 FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW 446
            F GKAV L+PS +E++  GR++MRKT +K+   SSGSPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW
Sbjct:   13 FAGKAVKLSPSSSEITGNGRVTMRKTATKAKPASSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW 132          
BLAST of CF504042 vs. ExPASy Swiss-Prot
Match: CB25_NICPL (Chlorophyll a-b binding protein E, chloroplastic OS=Nicotiana plumbaginifolia GN=CABE PE=3 SV=1)

HSP 1 Score: 218.394 bits (555), Expect = 1.067e-56
Identity = 101/120 (84.17%), Postives = 110/120 (91.67%), Query Frame = 3
Query:   93 FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW 446
            F GKAV L+PS +E++  G+++MRKT +K+  VSSGSPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW
Sbjct:   12 FAGKAVKLSPSSSEVTGNGKVTMRKTANKAKPVSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW 131          
BLAST of CF504042 vs. ExPASy Swiss-Prot
Match: CB22_TOBAC (Chlorophyll a-b binding protein 21, chloroplastic OS=Nicotiana tabacum GN=CAB21 PE=2 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 1.394e-56
Identity = 100/118 (84.75%), Postives = 107/118 (90.68%), Query Frame = 3
Query:   93 FVGKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW 446
            F G+AV L+PS  E++  GR+SMRKT +K V+S SPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW
Sbjct:   13 FAGQAVKLSPSAPEITGNGRVSMRKTVAKPVASSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW 130          
BLAST of CF504042 vs. ExPASy Swiss-Prot
Match: CB2B_SOLLC (Chlorophyll a-b binding protein 1B, chloroplastic OS=Solanum lycopersicum GN=CAB1B PE=3 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 2.378e-56
Identity = 100/118 (84.75%), Postives = 106/118 (89.83%), Query Frame = 3
Query:   93 FVGKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW 446
            F G+AV L+PS +E+S  GRI+MRK  +KS  S SPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW
Sbjct:   13 FAGQAVKLSPSASEISGNGRITMRKAVAKSAPSSSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW 130          
BLAST of CF504042 vs. ExPASy Swiss-Prot
Match: CB25_TOBAC (Chlorophyll a-b binding protein 50, chloroplastic OS=Nicotiana tabacum GN=CAB50 PE=2 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 4.056e-56
Identity = 100/120 (83.33%), Postives = 110/120 (91.67%), Query Frame = 3
Query:   93 FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW 446
            F GKAV L+PS +E++  G+++MRKT +K+  +SSGSPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW
Sbjct:   13 FAGKAVKLSPSSSEITGNGKVTMRKTVTKAKPLSSGSPWYGPDRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW 132          
BLAST of CF504042 vs. ExPASy Swiss-Prot
Match: CB23_NICPL (Chlorophyll a-b binding protein C, chloroplastic OS=Nicotiana plumbaginifolia GN=CABC PE=3 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 6.918e-56
Identity = 100/120 (83.33%), Postives = 109/120 (90.83%), Query Frame = 3
Query:   93 FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW 446
            F GKAV L+PS +E++  G+++MRKT SK+  VSS SPWYGP+RVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW
Sbjct:   13 FAGKAVKLSPSSSEITGNGKVTMRKTASKAKPVSSSSPWYGPNRVKYLGPFSGESPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW 132          
BLAST of CF504042 vs. ExPASy Swiss-Prot
Match: CB22_PETSP (Chlorophyll a-b binding protein 22L, chloroplastic OS=Petunia sp. GN=CAB22L PE=3 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 2.013e-55
Identity = 99/120 (82.50%), Postives = 107/120 (89.17%), Query Frame = 3
Query:   93 FVGKAVNLAPSGNELSNGGRISMRKTGSKS--VSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW 446
            F GK V L+PS +E++  G+ +MRKT +K+  VSSGSPWYGPDRVKYLGP SGE PSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPEL ARNGVKFGEAVW
Sbjct:   13 FAGKVVKLSPSSSEITGNGKATMRKTATKAKPVSSGSPWYGPDRVKYLGPFSGEAPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELFARNGVKFGEAVW 132          
BLAST of CF504042 vs. ExPASy Swiss-Prot
Match: CB21_CUCSA (Chlorophyll a-b binding protein of LHCII type I, chloroplastic (Fragment) OS=Cucumis sativus PE=2 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 2.013e-55
Identity = 98/116 (84.48%), Postives = 105/116 (90.52%), Query Frame = 3
Query:   99 GKAVNLAPSGNELSNGGRISMRKTGSKSVSSGSPWYGPDRVKYLGPLSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVW 446
            G+AV L+P+  E+    + +MRKT SKSVSSGSPWYGPDRVKYLGP SGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIH RWAMLGALGCVFPELL+RNGVKFGEAVW
Sbjct:    5 GQAVKLSPNAPEIQGNAKFTMRKTASKSVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNRELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVW 120          
The following BLAST results are available for this feature:
BLAST of CF504042 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 63
Match NameE-valueIdentityDescription
CB24_TOBAC3.668e-5785.00Chlorophyll a-b binding protein 40, chloroplastic ... [more]
CB21_TOBAC4.791e-5785.00Chlorophyll a-b binding protein 16, chloroplastic ... [more]
CB2G_SOLLC1.067e-5684.17Chlorophyll a-b binding protein 3C, chloroplastic ... [more]
CB25_NICPL1.067e-5684.17Chlorophyll a-b binding protein E, chloroplastic O... [more]
CB22_TOBAC1.394e-5684.75Chlorophyll a-b binding protein 21, chloroplastic ... [more]
CB2B_SOLLC2.378e-5684.75Chlorophyll a-b binding protein 1B, chloroplastic ... [more]
CB25_TOBAC4.056e-5683.33Chlorophyll a-b binding protein 50, chloroplastic ... [more]
CB23_NICPL6.918e-5683.33Chlorophyll a-b binding protein C, chloroplastic O... [more]
CB22_PETSP2.013e-5582.50Chlorophyll a-b binding protein 22L, chloroplastic... [more]
CB21_CUCSA2.013e-5584.48Chlorophyll a-b binding protein of LHCII type I, c... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-530 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-12_F12 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF504042 ID=CF504042|Name=CF504042|organism=Citrus sinensis|type=EST|length=447bp
CTCTTGCTTACACAGCTTCTATTGCTTACCCAGCTTCTGCTTCTCAATTA
AATTCCTCAATGGCAACCTCAACAATGGCTCTCTCCTCATCATTCGTCGG
CAAGGCCGTGAACCTCGCCCCTTCAGGCAATGAGCTGAGCAATGGTGGCC
GCATCTCCATGCGTAAAACCGGGAGCAAGTCTGTTTCTTCAGGTAGCCCG
TGGTACGGCCCGGACAGAGTCAAGTACTTGGGCCCACTCTCTGGCGAGCC
CCCAAGCTACTTGACTGGTGAGTTCCCTGGCGACTACGGTTGGGACACTG
CCGGGCTTTCAGCTGACCCAGAAACCTTTGCCAAGAACCGTGAACTCGAA
GTCATCCACTGCAGATGGGCCATGTTGGGAGCTCTTGGATGCGTCTTCCC
GGAGCTCTTGGCCCGCAACGGAGTCAAGTTCGGTGAGGCTGTGTGGT
back to top