CF504045

Overview
NameCF504045
Unique NameCF504045
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length549
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1532 contig Csv1_Contig1532:215..764. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF504045 vs. ExPASy Swiss-Prot
Match: CYT12_ORYSJ (Cysteine proteinase inhibitor 12 OS=Oryza sativa subsp. japonica GN=Os01g0270100 PE=2 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 6.203e-51
Identity = 85/132 (64.39%), Postives = 107/132 (81.06%), Query Frame = 3
Query:  153 QKENALLXXXXXXXXXXXXXXGTMHHLTVEAIDAGRKKLYEAKVWVKPWLNFKDLQEFKHVGDSPASFTSSDLGVKKDGHCPGWQAVPVHDPQVQDAANHAIQTIQQRSNSLFPYVLQEIVHAKAEVIEDFA 548
            ++ENALL              GT+HHLT+EA++AGRKK+YEAKVWVKPWL+FK+LQEF++ GD+  +FT++DLG KK GH PGW+ VPVHDP V+DAA+HA+++IQQRSNSLFPY L EIV AKAEV+EDFA
Sbjct:   76 KRENALLEFVRVVEAKEQVVAGTLHHLTLEALEAGRKKVYEAKVWVKPWLDFKELQEFRNTGDA-TTFTNADLGAKKGGHEPGWRDVPVHDPVVKDAADHAVKSIQQRSNSLFPYELLEIVRAKAEVVEDFA 206          

HSP 2 Score: 41.2022 bits (95), Expect = 6.203e-51
Identity = 23/58 (39.66%), Postives = 34/58 (58.62%), Query Frame = 1
Query:    4 LLLFLIISATANSEFCDDKMAL------LGGVQESRGAENSNEIESLARFAIEEHNKK 159
            L L L ++A A + F     +L      LGG  ++  A NS E ++LARFA++EHNK+
Sbjct:   20 LFLLLAVAAAAAALFLVGSASLAMAGHVLGGAHDAPSAANSVETDALARFAVDEHNKR 77          
BLAST of CF504045 vs. ExPASy Swiss-Prot
Match: CYT6_ARATH (Cysteine proteinase inhibitor 6 OS=Arabidopsis thaliana GN=CYS6 PE=1 SV=2)

HSP 1 Score: 157.147 bits (396), Expect = 3.306e-49
Identity = 79/132 (59.85%), Postives = 95/132 (71.97%), Query Frame = 3
Query:  153 QKENALLXXXXXXXXXXXXXXGTMHHLTVEAIDAGRKKLYEAKVWVKPWLNFKDLQEFKHVGDSPASFTSSDLGVKKDGHCPGWQAVPVHDPQVQDAANHAIQTIQQRSNSLFPYVLQEIVHAKAEVIEDFA 548
            +KENALL              GT+HHLT+E ++AG+KKLYEAKVWVKPWLNFK+LQEFK   D+PA  TSSDLG K+  H  GW+ VP  DP+V+  A  A++TIQQRSNSLFPY L E+VHAKAEV  + A
Sbjct:   65 KKENALLEFARVVKAKEQVVAGTLHHLTLEILEAGQKKLYEAKVWVKPWLNFKELQEFKPASDAPA-ITSSDLGCKQGEHESGWREVPGDDPEVKHVAEQAVKTIQQRSNSLFPYELLEVVHAKAEVTGEAA 195          

HSP 2 Score: 57.7658 bits (138), Expect = 3.306e-49
Identity = 27/53 (50.94%), Postives = 39/53 (73.58%), Query Frame = 1
Query:    1 SLLLFLIISATANSEFCDDKMALLGGVQESRGAENSNEIESLARFAIEEHNKK 159
            SL LF+     ++  FC+++MAL+GGV +    +NS E+ESLARFA++EHNKK
Sbjct:   14 SLSLFISSLIASDLGFCNEEMALVGGVGDVPANQNSGEVESLARFAVDEHNKK 66          
BLAST of CF504045 vs. ExPASy Swiss-Prot
Match: CYT7_ARATH (Cysteine proteinase inhibitor 7 OS=Arabidopsis thaliana GN=CYS7 PE=2 SV=2)

HSP 1 Score: 134.806 bits (338), Expect = 3.778e-34
Identity = 65/130 (50.00%), Postives = 94/130 (72.31%), Query Frame = 3
Query:  153 QKENALLXXXXXXXXXXXXXXGTMHHLTVEAIDAGRKKLYEAKVWVKPWLNFKDLQEFKHVGDSPASFTSSDLGVKKDGHCPGWQAVPVHDPQVQDAANHAIQTIQQRSNSLFPYVLQEIVHAKAEVIED 542
            ++ENA+L              G ++ LT+E I+AG KK+YEAKVWVKPW+NFK LQEFK++     SFT SDLG K DG+   W++V  ++P+VQ+AA HA++++QQ+SNSLFPY L +I+ A+A+V+E+
Sbjct:   74 RRENAVLELARVLKATEQVVAGKLYRLTLEVIEAGEKKIYEAKVWVKPWMNFKQLQEFKNI---IPSFTISDLGFKPDGNGFDWRSVSTNNPEVQEAAKHAMKSLQQKSNSLFPYKLIDIILARAKVVEE 200          

HSP 2 Score: 29.6462 bits (65), Expect = 3.778e-34
Identity = 13/31 (41.94%), Postives = 21/31 (67.74%), Query Frame = 1
Query:   70 LGGVQESRGAENSN-EIESLARFAIEEHNKK 159
            LGG  +S+   N   EI+ +A FA++EHN++
Sbjct:   45 LGGFSDSKNDWNGGKEIDDIALFAVQEHNRR 75          
BLAST of CF504045 vs. ExPASy Swiss-Prot
Match: CYTI_VIGUN (Cysteine proteinase inhibitor OS=Vigna unguiculata PE=3 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 6.144e-24
Identity = 38/66 (57.58%), Postives = 48/66 (72.73%), Query Frame = 3
Query:  153 QKENALLXXXXXXXXXXXXXXGTMHHLTVEAIDAGRKKLYEAKVWVKPWLNFKDLQEFKHVGDSPA 350
            +K+NALL              GT++ +T+EA D G+KK+YEAKVW KPWLNFK+LQEFKHVGD+PA
Sbjct:   32 KKQNALLEFGRVVSAQQQVVSGTLYTITLEAKDGGQKKVYEAKVWEKPWLNFKELQEFKHVGDAPA 97          

HSP 2 Score: 46.9802 bits (110), Expect = 6.144e-24
Identity = 22/34 (64.71%), Postives = 28/34 (82.35%), Query Frame = 1
Query:   61 MALLGGVQESRGAENSNEIESLARFAIEEHNKKR 162
            MA LGG ++  G +NS EI+SLARFA+EEHNKK+
Sbjct:    1 MAALGGNRDVAGNQNSLEIDSLARFAVEEHNKKQ 34          
BLAST of CF504045 vs. ExPASy Swiss-Prot
Match: CYT3_ARATH (Cysteine proteinase inhibitor 3 OS=Arabidopsis thaliana GN=CYS3 PE=2 SV=2)

HSP 1 Score: 62.003 bits (149), Expect = 4.987e-19
Identity = 28/59 (47.46%), Postives = 38/59 (64.41%), Query Frame = 3
Query:  153 QKENALLXXXXXXXXXXXXXXGTMHHLTVEAIDAGRKKLYEAKVWVKPWLNFKDLQEFK 329
            +++N +L              GTM+HLT+EA +  + K +EAKVWVKPW+NFK LQEFK
Sbjct:   63 KQQNKILEFKKIVKAREQVVAGTMYHLTLEAKEGDQTKNFEAKVWVKPWMNFKQLQEFK 121          

HSP 2 Score: 51.6026 bits (122), Expect = 4.987e-19
Identity = 24/42 (57.14%), Postives = 32/42 (76.19%), Query Frame = 1
Query:   37 NSEFCDDKMALLGGVQESRGAENSNEIESLARFAIEEHNKKR 162
            + E   +K  +LGGV + RG +NS EIESLARFAI+EHNK++
Sbjct:   24 SEEKSTEKTMMLGGVHDLRGNQNSGEIESLARFAIQEHNKQQ 65          
BLAST of CF504045 vs. ExPASy Swiss-Prot
Match: CYT1_MAIZE (Cystatin-1 OS=Zea mays GN=RAMDAZC7 PE=2 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 1.606e-16
Identity = 34/67 (50.75%), Postives = 40/67 (59.70%), Query Frame = 3
Query:  153 QKENALLXXXXXXXXXXXXXXGTMHHLTVEAIDAGRKKLYEAKVWVKPWLNFKDLQEFKHVGDSPAS 353
            QK NALL              GTM++LT+E  D   KKLYEAKVW KPW NFK LQEFK V +  ++
Sbjct:   69 QKANALLGFEKLVKAKTQVVAGTMYYLTIEVKDGEVKKLYEAKVWEKPWENFKQLQEFKPVEEGASA 135          

HSP 2 Score: 38.5058 bits (88), Expect = 1.606e-16
Identity = 19/55 (34.55%), Postives = 33/55 (60.00%), Query Frame = 1
Query:    4 LLLFLIISATANSE---FCDDKMALLGGVQESRGAENSNEIESLARFAIEEHNKK 159
            LL    +S+T +++     D+   L GG+++    EN  +++ LARFA+ EHN+K
Sbjct:   16 LLALAAVSSTRSTQKESVADNAGMLAGGIKDVPANENDLQLQELARFAVNEHNQK 70          
BLAST of CF504045 vs. ExPASy Swiss-Prot
Match: CYTM_SOLTU (Multicystatin OS=Solanum tuberosum PE=2 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 2.600e-16
Identity = 45/129 (34.88%), Postives = 69/129 (53.49%), Query Frame = 3
Query:  153 QKENALLXXXXXXXXXXXXXXGTMHHLTVEAIDAGRKKLYEAKVWVKPWLNFKDLQEFKHVGDSPASFTSSDLGVKKDGHCPGWQAVPV-HDPQVQDAANHAIQTIQQRSNSLFPYVLQEIVHAKAEVI 536
            +KENA L              G ++++T+ AIDAG+KK+YEAK+WVK W NFK + EFK +GD  A                G+  VP  ++P+ QD A  A+Q   ++ N+   YV  E ++ K +++
Sbjct:  503 KKENAHLEFVENLNVKEQLVAGMLYYITLVAIDAGKKKIYEAKIWVKEWENFKKVIEFKLIGDDSAII-------------GGFTDVPFPNNPEFQDLARFAVQDYNKKENAHLEYV--ENLNVKEQLV 616          

HSP 2 Score: 28.8758 bits (63), Expect = 2.600e-16
Identity = 15/35 (42.86%), Postives = 22/35 (62.86%), Query Frame = 1
Query:   55 DKMALLGGVQESRGAENSNEIESLARFAIEEHNKK 159
            D  A LGG+       N+ E + LARFA++++NKK
Sbjct:  471 DDSAKLGGIINVP-FPNNPEFQDLARFAVQDYNKK 504          

HSP 3 Score: 70.4774 bits (171), Expect = 4.641e-15
Identity = 46/129 (35.66%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  153 QKENALLXXXXXXXXXXXXXXGTMHHLTVEAIDAGRKKLYEAKVWVKPWLNFKDLQEFKHVGDSPASFTSSDLGVKKDGHCPGWQAVPV-HDPQVQDAANHAIQTIQQRSNSLFPYVLQEIVHAKAEVI 536
            +KENA L              G ++++T+ A DAG+KK+YEAK+WVK W +FK + EFK VGD  A          K G   G   VP  + P+ QD A  A+Q   ++ N    +V  E ++ K +V+
Sbjct:  597 KKENAHLEYVENLNVKEQLVAGMIYYITLVATDAGKKKIYEAKIWVKEWEDFKKVVEFKLVGDDSA----------KPG---GIIIVPFPNSPEFQDLARFAVQDFNKKENGHLEFV--ENLNVKEQVV 710          

HSP 4 Score: 29.6462 bits (65), Expect = 4.641e-15
Identity = 14/35 (40.00%), Postives = 23/35 (65.71%), Query Frame = 1
Query:   55 DKMALLGGVQESRGAENSNEIESLARFAIEEHNKK 159
            D  A++GG  +     N+ E + LARFA++++NKK
Sbjct:  565 DDSAIIGGFTDVP-FPNNPEFQDLARFAVQDYNKK 598          

HSP 5 Score: 68.5514 bits (166), Expect = 1.323e-14
Identity = 42/128 (32.81%), Postives = 63/128 (49.22%), Query Frame = 3
Query:  153 QKENALLXXXXXXXXXXXXXXGTMHHLTVEAIDAGRKKLYEAKVWVKPWLNFKDLQEFKHVGDSPASFTSSDLGVKKDGHCPGWQAVPVHDPQVQDAANHAIQTIQQRSNSLFPYVLQEIVHAKAEVI 536
            +KEN  L              G M+++T+ AIDAG+KK+YE K+WVK W +FK + EFK VGD  A  T   + V              + P+ QD A  A+Q      N+   +V  E ++ K +++
Sbjct:  220 KKENVHLEFVENLNVKQQVVAGMMYYITLAAIDAGKKKIYETKIWVKEWEDFKKVVEFKLVGDDSAK-TGGIINVPNP-----------NSPEFQDLARFAVQDYNNTQNAHLEFV--ENLNVKEQLV 333          

HSP 6 Score: 30.0314 bits (66), Expect = 1.323e-14
Identity = 16/35 (45.71%), Postives = 23/35 (65.71%), Query Frame = 1
Query:   55 DKMALLGGVQESRGAENSNEIESLARFAIEEHNKK 159
            D +A LGG+ +     N+ E + LARFAI+ +NKK
Sbjct:  188 DDIAKLGGITDVP-FPNNPEFQDLARFAIQVYNKK 221          

HSP 7 Score: 65.4698 bits (158), Expect = 5.149e-13
Identity = 45/129 (34.88%), Postives = 67/129 (51.94%), Query Frame = 3
Query:  153 QKENALLXXXXXXXXXXXXXXGTMHHLTVEAID-AGRKKLYEAKVWVKPWLNFKDLQEFKHVGDSPASFTSSDLGVKKDGHCPGWQAVPVHDPQVQDAANHAIQTIQQRSNSLFPYVLQEIVHAKAEVI 536
            +K+NA L              G M+++T+ A D AG+KK+Y+AK+WVK W +FK + EFK VGD  A      LG   D   P       ++P+ QD A  AIQ   ++ N    +V  E ++ K +V+
Sbjct:  125 KKQNAHLEFVENLNVKEQVVAGIMYYITLAATDDAGKKKIYKAKIWVKEWEDFKKVVEFKLVGDDIAK-----LGGITDVPFP-------NNPEFQDLARFAIQVYNKKENVHLEFV--ENLNVKQQVV 239          

HSP 8 Score: 27.7202 bits (60), Expect = 5.149e-13
Identity = 10/20 (50.00%), Postives = 17/20 (85.00%), Query Frame = 1
Query:  103 NSNEIESLARFAIEEHNKKR 162
            N+ + + LARFAI+++NKK+
Sbjct:  108 NNTKFQELARFAIQDYNKKQ 127          

HSP 9 Score: 65.0846 bits (157), Expect = 2.469e-12
Identity = 39/108 (36.11%), Postives = 61/108 (56.48%), Query Frame = 3
Query:  216 GTMHHLTVEAIDAGRKKLYEAKVWVKPWLNFKDLQEFKHVGDSPASFTSSDLGVKKDGHCPGWQAVPV-HDPQVQDAANHAIQTIQQRSNSLFPYVLQEIVHAKAEVI 536
            G ++++T  A D G+KK+YE K+WVK W NFK + EFK VGD      S+ LG        G   VP  ++P+ QD A  A+Q   ++ N+   +V  E ++ K +++
Sbjct:  430 GMLYYITFAATDGGKKKIYETKIWVKVWENFKKVVEFKLVGDD-----SAKLG--------GIINVPFPNNPEFQDLARFAVQDYNKKENAHLEFV--ENLNVKEQLV 522          

HSP 10 Score: 25.7942 bits (55), Expect = 2.469e-12
Identity = 14/35 (40.00%), Postives = 19/35 (54.29%), Query Frame = 1
Query:   52 DDKMALLGGVQESRGAENSNEIESLARFAIEEHNK 156
            +D    LGG  E     NS E + L RFA+ ++NK
Sbjct:  376 NDSAKKLGGFTEVP-FPNSPEFQDLTRFAVHQYNK 409          

HSP 11 Score: 61.6178 bits (148), Expect = 4.356e-11
Identity = 39/108 (36.11%), Postives = 59/108 (54.63%), Query Frame = 3
Query:  216 GTMHHLTVEAIDAGRKKLYEAKVWVKPWLNFKDLQEFKHVGDSPASFTSSDLGVKKDGHCPGWQAVPV-HDPQVQDAANHAIQTIQQRSNSLFPYVLQEIVHAKAEVI 536
            G M+++T+ A DAG KK YEAK+WVK W +FK + +FK VG+  A         KK G   G+  VP  + P+ QD    A+    +  N+   +V  E ++ K +V+
Sbjct:  335 GMMYYITLAATDAGNKKEYEAKIWVKEWEDFKKVIDFKLVGNDSA---------KKLG---GFTEVPFPNSPEFQDLTRFAVHQYNKDQNAHLEFV--ENLNVKKQVV 428          

HSP 12 Score: 25.0238 bits (53), Expect = 4.356e-11
Identity = 9/17 (52.94%), Postives = 14/17 (82.35%), Query Frame = 1
Query:  103 NSNEIESLARFAIEEHN 153
            NS E + LARFA++++N
Sbjct:  297 NSPEFQDLARFAVQDYN 313          
BLAST of CF504045 vs. ExPASy Swiss-Prot
Match: CYTA_HELAN (Cysteine proteinase inhibitor A OS=Helianthus annuus PE=1 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 1.879e-14
Identity = 32/61 (52.46%), Postives = 40/61 (65.57%), Query Frame = 3
Query:  153 QKENALLXXXXXXXXXXXXXXGTMHHLTVEAIDAGRKKLYEAKVWVKPWLNFKDLQEFKHV 335
            +K+NALL              G M+++T+EA + G KK YEAKVWVKPW NFK+LQEFK V
Sbjct:   17 KKQNALLEFGKVVNTKEQVVAGKMYYITLEATNGGVKKTYEAKVWVKPWENFKELQEFKPV 77          

HSP 2 Score: 31.5722 bits (70), Expect = 1.879e-14
Identity = 13/19 (68.42%), Postives = 17/19 (89.47%), Query Frame = 1
Query:  106 SNEIESLARFAIEEHNKKR 162
            S EI+ LARFA++EHNKK+
Sbjct:    1 SLEIDELARFAVDEHNKKQ 19          
BLAST of CF504045 vs. ExPASy Swiss-Prot
Match: CYT1_HORVU (Cysteine proteinase inhibitor OS=Hordeum vulgare GN=ICY PE=1 SV=1)

HSP 1 Score: 61.2326 bits (147), Expect = 3.996e-14
Identity = 30/58 (51.72%), Postives = 33/58 (56.90%), Query Frame = 3
Query:  156 KENALLXXXXXXXXXXXXXXGTMHHLTVEAIDAGRKKLYEAKVWVKPWLNFKDLQEFK 329
            K NALL              G MH+ T+E  + G KKLYEAKVW K W NFK LQEFK
Sbjct:   47 KANALLEFEKLVKVRQQVVAGCMHYFTIEVKEGGAKKLYEAKVWEKAWENFKQLQEFK 104          

HSP 2 Score: 35.8094 bits (81), Expect = 3.996e-14
Identity = 19/32 (59.38%), Postives = 22/32 (68.75%), Query Frame = 1
Query:   67 LLGGVQES-RGAENSNEIESLARFAIEEHNKK 159
            LLGGVQ++  G EN  E   LARFA+ EHN K
Sbjct:   16 LLGGVQDAPAGRENDLETIELARFAVAEHNAK 47          
BLAST of CF504045 vs. ExPASy Swiss-Prot
Match: CYT3_ORYSJ (Cysteine proteinase inhibitor 3 OS=Oryza sativa subsp. japonica GN=Os05g0409300 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 8.568e-14
Identity = 32/58 (55.17%), Postives = 44/58 (75.86%), Query Frame = 3
Query:  216 GTMHHLTVEAIDAGRKKLYEAKVWVKPWLNFKDLQEFKHVGDSPA-SFTSSDLGVKKD 386
            GT+H L +E +D+G+K LY AKVWVKPWL+FK + EF+HVGDS + S T++D    +D
Sbjct:   94 GTLHDLMLEVVDSGKKSLYSAKVWVKPWLDFKAVVEFRHVGDSQSQSATAADDNAGQD 151          

HSP 2 Score: 25.0238 bits (53), Expect = 8.568e-14
Identity = 18/57 (31.58%), Postives = 29/57 (50.88%), Query Frame = 1
Query:    1 SLLLFLIISAT---ANSEFCDDKMALLGGVQESRGAENSNEIESLARFAIEEHNKKR 162
            +LLL  + +A    A      D+  L+ G+  +   E + E E  ARFA+ E+NK +
Sbjct:   20 ALLLLAVAAAAPRAAGFHLGGDESVLVRGMLAAIRREQA-EAEDAARFAVAEYNKNQ 75          
The following BLAST results are available for this feature:
BLAST of CF504045 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 12
Match NameE-valueIdentityDescription
CYT12_ORYSJ6.203e-5164.39Cysteine proteinase inhibitor 12 OS=Oryza sativa s... [more]
CYT6_ARATH3.306e-4959.85Cysteine proteinase inhibitor 6 OS=Arabidopsis tha... [more]
CYT7_ARATH3.778e-3450.00Cysteine proteinase inhibitor 7 OS=Arabidopsis tha... [more]
CYTI_VIGUN6.144e-2457.58Cysteine proteinase inhibitor OS=Vigna unguiculata... [more]
CYT3_ARATH4.987e-1947.46Cysteine proteinase inhibitor 3 OS=Arabidopsis tha... [more]
CYT1_MAIZE1.606e-1650.75Cystatin-1 OS=Zea mays GN=RAMDAZC7 PE=2 SV=1[more]
CYTM_SOLTU2.600e-1634.88Multicystatin OS=Solanum tuberosum PE=2 SV=1[more]
CYTA_HELAN1.879e-1452.46Cysteine proteinase inhibitor A OS=Helianthus annu... [more]
CYT1_HORVU3.996e-1451.72Cysteine proteinase inhibitor OS=Hordeum vulgare G... [more]
CYT3_ORYSJ8.568e-1455.17Cysteine proteinase inhibitor 3 OS=Oryza sativa su... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-533 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-12_G04 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF504045 ID=CF504045|Name=CF504045|organism=Citrus sinensis|type=EST|length=549bp
TCTCTGCTTCTGTTTCTGATCATATCTGCGACGGCAAATTCTGAATTTTG
CGACGATAAAATGGCCTTGCTTGGCGGAGTACAGGAATCCCGAGGTGCCG
AAAACAGCAATGAAATTGAAAGCCTCGCTCGATTCGCCATCGAAGAACAC
AACAAAAAGAGAATGCTTTGCTGGAGTTTGTGAAAGTGGTGAAGGCGCAA
GAGCAGGTGGTTGCTGGTACCATGCATCATCTAACAGTGGAGGCTATTGA
TGCTGGTAGGAAGAAGCTATACGAAGCGAAAGTGTGGGTCAAGCCATGGT
TGAATTTTAAGGATTTGCAGGAATTTAAGCACGTTGGTGATTCCCCCGCC
TCTTTCACCTCTTCAGATCTTGGTGTTAAGAAAGATGGTCATTGCCCTGG
ATGGCAGGCAGTTCCCGTACATGATCCTCAAGTCCAGGATGCAGCCAATC
ATGCTATCCAAACCATTCAGCAAAGGTCCAACTCCCTCTTCCCTTATGTA
CTTCAGGAGATTGTTCATGCAAAAGCTGAGGTGATTGAGGATTTTGCGA
back to top