CF504128

Overview
NameCF504128
Unique NameCF504128
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length412
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig9802 contig Csv1_Contig9802:42..454. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF504128 vs. ExPASy Swiss-Prot
Match: CHIB_VITVI (Basic endochitinase OS=Vitis vinifera GN=CHIT1B PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 6.119e-21
Identity = 49/99 (49.49%), Postives = 65/99 (65.66%), Query Frame = 2
Query:  104 CGSGV-VCGERDTGHGTDGGELGKIISREMFEDLLPYRNDARCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQLAMKLLG------DGP 379
            CG+    CG       +  G++G++I+R MF D+L +RN+  CP +GFYTYDAFI AA+AFPGFG +G+ T RKREIAAF AQ + +  G      DGP
Sbjct:   44 CGNTADYCGSGCQSQCSSTGDIGQLITRSMFNDMLKHRNEGSCPGKGFYTYDAFIAAAKAFPGFGTTGDTTTRKREIAAFLAQTSHETTGGWASAPDGP 142          
BLAST of CF504128 vs. ExPASy Swiss-Prot
Match: CHI6_POPTR (Acidic endochitinase WIN6 OS=Populus trichocarpa GN=WIN6 PE=2 SV=2)

HSP 1 Score: 95.5153 bits (236), Expect = 8.836e-20
Identity = 47/85 (55.29%), Postives = 57/85 (67.06%), Query Frame = 2
Query:  125 GERDTGHGTDGGELGKIISREMFEDLLPYRNDARCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQLAMKLLGDGP 379
            G  D G   D G L  II +  F+ LL +RNDARCPA GFYTY+AFI AA+ FP FGN+G++ MRKREIAAF  Q + +  G  P
Sbjct:   76 GGDDGGGDGDDGYLSDIIPKSKFDALLKFRNDARCPAAGFYTYNAFISAAKEFPDFGNTGDDLMRKREIAAFLGQTSHETTGGWP 160          
BLAST of CF504128 vs. ExPASy Swiss-Prot
Match: CHI2_TOBAC (Endochitinase B OS=Nicotiana tabacum GN=CHN50 PE=1 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 8.836e-20
Identity = 52/100 (52.00%), Postives = 65/100 (65.00%), Query Frame = 2
Query:  104 CGSGVVCGERDTGHGTD--GGELGKIISREMFEDLLPYRNDARCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQLAMKLLG------DGP 379
            CG G  C  +  G  T   GG+LG IIS  MF+ +L +RND  C  +GFY+Y+AFI AA++FPGFG SG+ T RKREIAAFFAQ + +  G      DGP
Sbjct:   54 CGPGN-CQSQCPGGPTPPGGGDLGSIISSSMFDQMLKHRNDNACQGKGFYSYNAFINAARSFPGFGTSGDTTARKREIAAFFAQTSHETTGGWATAPDGP 152          
BLAST of CF504128 vs. ExPASy Swiss-Prot
Match: CHI2_BRANA (Endochitinase CH25 OS=Brassica napus PE=2 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 8.836e-20
Identity = 46/80 (57.50%), Postives = 57/80 (71.25%), Query Frame = 2
Query:  158 GELGKIISREMFEDLLPYRNDARCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQLAMKLLG------DGP 379
            G+L  IISR  F+D+L +RND  CPARGFYTYDAFI AA++FPGFG +G+   RK+EIAAFF Q + +  G      DGP
Sbjct:   69 GDLSGIISRSQFDDMLKHRNDNACPARGFYTYDAFINAAKSFPGFGTTGDTATRKKEIAAFFGQTSHETTGGWATAPDGP 148          
BLAST of CF504128 vs. ExPASy Swiss-Prot
Match: CHI1_TOBAC (Endochitinase A OS=Nicotiana tabacum GN=CHN48 PE=1 SV=2)

HSP 1 Score: 94.7449 bits (234), Expect = 1.507e-19
Identity = 46/81 (56.79%), Postives = 58/81 (71.60%), Query Frame = 2
Query:  155 GGELGKIISREMFEDLLPYRNDARCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQLAMKLLG------DGP 379
            GG+LG IIS  MF+ +L +RND  C  +GFY+Y+AFI AA++FPGFG SG+ T RKREIAAFFAQ + +  G      DGP
Sbjct:   77 GGDLGSIISSSMFDQMLKHRNDNACQGKGFYSYNAFINAARSFPGFGTSGDTTARKREIAAFFAQTSHETTGGWATAPDGP 157          
BLAST of CF504128 vs. ExPASy Swiss-Prot
Match: CHI1_THECC (Endochitinase 1 OS=Theobroma cacao GN=CHIA1 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 1.969e-19
Identity = 46/93 (49.46%), Postives = 61/93 (65.59%), Query Frame = 2
Query:  122 CGERDTGHGTDGGELGKIISREMFEDLLPYRNDARCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQLAMKLLG-------DGP 379
            C  + +G G D G L  +I+RE F+ +L +RND  CPARGFYTYDAFI AA++FP F  +G++  RKRE+AAF AQ + +  G       DGP
Sbjct:   58 CQSQCSGSGGDTGGLDSLITRERFDQMLLHRNDGGCPARGFYTYDAFIAAAKSFPAFATTGDDATRKREVAAFLAQTSHETTGGAGWAAPDGP 150          
BLAST of CF504128 vs. ExPASy Swiss-Prot
Match: CHIA_SOLCI (Acidic endochitinase pcht28 OS=Solanum chilense PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 2.571e-19
Identity = 42/75 (56.00%), Postives = 56/75 (74.67%), Query Frame = 2
Query:  146 GTDGGELGKIISREMFEDLLPYRNDARCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQLAMKLLG 370
            GT     G I++RE+FE +L +RN+  CPA+GFYTYDAFI AA +FPGFG +G++T RK+EIAAFF Q + +  G
Sbjct:   21 GTLAQNAGSIVTRELFEQMLSFRNNDACPAKGFYTYDAFIAAANSFPGFGTTGDDTARKKEIAAFFGQTSHETKG 95          
BLAST of CF504128 vs. ExPASy Swiss-Prot
Match: CHIA_SOLLC (Acidic 26 kDa endochitinase OS=Solanum lycopersicum GN=CHI3 PE=1 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 3.358e-19
Identity = 42/75 (56.00%), Postives = 56/75 (74.67%), Query Frame = 2
Query:  146 GTDGGELGKIISREMFEDLLPYRNDARCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQLAMKLLG 370
            GT     G I++RE+FE +L +RN+  CPA+GFYTYDAFI AA +FPGFG +G++T RK+EIAAFF Q + +  G
Sbjct:   21 GTLAQNAGSIVTRELFEQMLSFRNNDACPAKGFYTYDAFIAAANSFPGFGTAGDDTARKKEIAAFFGQTSHETNG 95          
BLAST of CF504128 vs. ExPASy Swiss-Prot
Match: CHIB_SOLLC (Acidic 27 kDa endochitinase OS=Solanum lycopersicum GN=CHI17 PE=1 SV=1)

HSP 1 Score: 93.2041 bits (230), Expect = 4.385e-19
Identity = 43/83 (51.81%), Postives = 60/83 (72.29%), Query Frame = 2
Query:  146 GTDGGELGKIISREMFEDLLPYRNDARCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQLAMKLLG-----DGP 379
            G+   ++G I++ ++F ++L  RND RCPA+GFYTYDAFI AA +FPGFG +G++T RK+EIAAFF Q + +  G     DGP
Sbjct:   13 GSFAQDVGTIVTSDLFNEMLKNRNDDRCPAKGFYTYDAFIAAANSFPGFGTTGDDTARKKEIAAFFGQTSHETTGGSLSADGP 95          
BLAST of CF504128 vs. ExPASy Swiss-Prot
Match: CHIB_POPTR (Acidic endochitinase WIN6.2B OS=Populus trichocarpa PE=2 SV=2)

HSP 1 Score: 93.2041 bits (230), Expect = 4.385e-19
Identity = 48/91 (52.75%), Postives = 58/91 (63.74%), Query Frame = 2
Query:  107 GSGVVCGERDTGHGTDGGELGKIISREMFEDLLPYRNDARCPARGFYTYDAFIEAAQAFPGFGNSGNETMRKREIAAFFAQLAMKLLGDGP 379
            G G   G    G G   G L  II   MF+D+L YRND +CPA GFYTY+AFI AA+ FP FGN+G++ MRKREIAAF  Q + +  G  P
Sbjct:   66 GGGGGGGGGGGGGGGGDGYLSDIIPESMFDDMLKYRNDPQCPAVGFYTYNAFISAAKEFPDFGNTGDDLMRKREIAAFLGQTSHETNGWWP 156          
The following BLAST results are available for this feature:
BLAST of CF504128 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 44
Match NameE-valueIdentityDescription
CHIB_VITVI6.119e-2149.49Basic endochitinase OS=Vitis vinifera GN=CHIT1B PE... [more]
CHI6_POPTR8.836e-2055.29Acidic endochitinase WIN6 OS=Populus trichocarpa G... [more]
CHI2_TOBAC8.836e-2052.00Endochitinase B OS=Nicotiana tabacum GN=CHN50 PE=1... [more]
CHI2_BRANA8.836e-2057.50Endochitinase CH25 OS=Brassica napus PE=2 SV=1[more]
CHI1_TOBAC1.507e-1956.79Endochitinase A OS=Nicotiana tabacum GN=CHN48 PE=1... [more]
CHI1_THECC1.969e-1949.46Endochitinase 1 OS=Theobroma cacao GN=CHIA1 PE=2 S... [more]
CHIA_SOLCI2.571e-1956.00Acidic endochitinase pcht28 OS=Solanum chilense PE... [more]
CHIA_SOLLC3.358e-1956.00Acidic 26 kDa endochitinase OS=Solanum lycopersicu... [more]
CHIB_SOLLC4.385e-1951.81Acidic 27 kDa endochitinase OS=Solanum lycopersicu... [more]
CHIB_POPTR4.385e-1952.75Acidic endochitinase WIN6.2B OS=Populus trichocarp... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-616 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-14_B08 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF504128 ID=CF504128|Name=CF504128|organism=Citrus sinensis|type=EST|length=412bp
GATAATTGATATCATAACTCTTGCTTTCAAAATGAGGCTCATTGGGTCCT
TACTAATTTTCTCTCTAGTTTTATCTTTTGTACTAGGAGGTTCAGCACAG
AATTGTGGAAGCGGCGTTGTGTGCGGTGAACGTGATACTGGCCACGGGAC
GGATGGCGGTGAACTGGGCAAGATCATCTCAAGGGAGATGTTTGAAGACT
TGCTTCCGTATAGAAATGATGCCCGATGCCCTGCCAGAGGCTTCTACACT
TATGATGCTTTTATAGAGGCAGCCCAAGCTTTTCCAGGCTTTGGTAACTC
TGGAAATGAAACCATGCGTAAAAGAGAAATTGCTGCCTTTTTTGCCCAAC
TGGCCATGAAACTACTGGGGGATGGACCGATGCACCTGGTGGAGAATATG
CTTGGGGATATT
back to top