CF504293

Overview
NameCF504293
Unique NameCF504293
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length585
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig6651 contig Csv1_Contig6651:106..691. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF504293 vs. ExPASy Swiss-Prot
Match: PPA1_SOLLC (Acid phosphatase 1 OS=Solanum lycopersicum GN=APS1 PE=2 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 3.847e-26
Identity = 49/103 (47.57%), Postives = 75/103 (72.82%), Query Frame = 1
Query:  211 LSCLSWRLGVETNNVIGWATVPEKCAGYVGHYMLGQQYRMDSEVVANEAILYAQSLKLAGDGKNIWVFDIDETSLSNLPYYAKNGFGVKPYNPTLFNEWVNTG 519
            L C +WR  VETNN+  W T+PE+CA YV  YM+G  Y+M+ + V++EA  YA+S+ L  DG+++W+FD+DET LSNLPYY+ + +G++ ++   F++WV  G
Sbjct:   41 LKCTTWRFVVETNNLSPWKTIPEECADYVKEYMVGPGYKMEIDRVSDEAGEYAKSVDLGDDGRDVWIFDVDETLLSNLPYYSDHRYGLEVFDDVEFDKWVENG 143          
BLAST of CF504293 vs. ExPASy Swiss-Prot
Match: VSPA_SOYBN (Stem 28 kDa glycoprotein OS=Glycine max GN=VSPA PE=2 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 3.600e-24
Identity = 54/120 (45.00%), Postives = 76/120 (63.33%), Query Frame = 1
Query:  205 PGLSCLSWRLGVETNNVIGWATVPEKCAGYVGHYMLGQQYRMDSEVVANEAILYAQSLKLAGDGKNIWVFDIDETSLSNLPYYAKNGFGVKPYNPTLFNEWVNTGKHHRCQRALSFTKNY 564
            P + C SWRL VE +N+ G+ T+PE+C      Y+ G+QYR DS+ V  +A  YA+ L++    K+ +VF ID T LSN+PYY K+G+GV+ +N TL++EWVN G        L   KNY
Sbjct:   38 PEVKCASWRLAVEAHNIFGFETIPEECVEATKEYIHGEQYRSDSKTVNQQAYFYARDLEV--HPKDTFVFSIDGTVLSNIPYYKKHGYGVEKFNSTLYDEWVNKGNAPALPETL---KNY 152          
BLAST of CF504293 vs. ExPASy Swiss-Prot
Match: S25K_SOYBN (Stem 31 kDa glycoprotein (Fragment) OS=Glycine max GN=VSP25 PE=2 SV=2)

HSP 1 Score: 111.309 bits (277), Expect = 3.600e-24
Identity = 54/120 (45.00%), Postives = 76/120 (63.33%), Query Frame = 1
Query:  205 PGLSCLSWRLGVETNNVIGWATVPEKCAGYVGHYMLGQQYRMDSEVVANEAILYAQSLKLAGDGKNIWVFDIDETSLSNLPYYAKNGFGVKPYNPTLFNEWVNTGKHHRCQRALSFTKNY 564
            P + C SWRL VE +N+ G+ T+PE+C      Y+ G+QYR DS+ V  +A  YA+ L++    K+ +VF ID T LSN+PYY K+G+GV+ +N TL++EWVN G        L   KNY
Sbjct:   35 PEVKCASWRLAVEAHNIFGFETIPEECVEATKEYIHGEQYRSDSKTVNQQAYFYARDLEV--HPKDTFVFSIDGTVLSNIPYYKKHGYGVEKFNSTLYDEWVNKGNAPALPETL---KNY 149          
BLAST of CF504293 vs. ExPASy Swiss-Prot
Match: VSP1_ARATH (Vegetative storage protein 1 OS=Arabidopsis thaliana GN=VSP1 PE=2 SV=2)

HSP 1 Score: 108.227 bits (269), Expect = 3.048e-23
Identity = 61/157 (38.85%), Postives = 87/157 (55.41%), Query Frame = 1
Query:   82 SMDIRHLFLATISATSHGFSMDIPHQIHLLRPKAGSRNN----DVPGLS-----CLSWRLGVETNNVIGWATVPEKCAGYVGHYML-GQQYRMDSEVVANEAILYAQSLKLAGDGKNIWVFDIDETSLSNLPYYAKNGFGVKPYNPTLFNEWVNTGK 522
            S+ +  L  AT+S      S  +P  I LL       N     +  GLS     C SW LGVET+N+I + TVP  C  YV  Y++  +QY+ DS+ V  EA  YA+ L L  D  N+W+FD+D+T LS++PYYAK G+G +   P  +  W+ +G+
Sbjct:    5 SLSLLLLLAATVSHVQS--SASVPGLIELLESNTIFGNEAELLEKEGLSINYPNCRSWHLGVETSNIINFDTVPANCKAYVEDYLITSKQYQYDSKTVNKEAYFYAKGLALKNDTVNVWIFDLDDTLLSSIPYYAKYGYGTENTAPGAYWSWLESGE 159          
BLAST of CF504293 vs. ExPASy Swiss-Prot
Match: VSP2_ARATH (Vegetative storage protein 2 OS=Arabidopsis thaliana GN=VSP2 PE=1 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 3.981e-23
Identity = 48/103 (46.60%), Postives = 69/103 (66.99%), Query Frame = 1
Query:  214 SCLSWRLGVETNNVIGWATVPEKCAGYVGHYML-GQQYRMDSEVVANEAILYAQSLKLAGDGKNIWVFDIDETSLSNLPYYAKNGFGVKPYNPTLFNEWVNTG 519
            +C SW LGVET+N+I + TVP  C  YV  Y++  +QY+ DS+ V  EA  YA+ L L  D  N+W+FD+D+T LS++PYYAK G+G +  +P  +  W+ TG
Sbjct:   51 NCRSWHLGVETSNIIDFDTVPANCKDYVEDYLITSKQYQYDSKTVCKEAYFYAKGLALKNDTVNVWIFDLDDTLLSSIPYYAKYGYGTEKTDPGAYWLWLGTG 153          
BLAST of CF504293 vs. ExPASy Swiss-Prot
Match: VSPB_SOYBN (Stem 31 kDa glycoprotein OS=Glycine max GN=VSPB PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 2.415e-20
Identity = 47/112 (41.96%), Postives = 74/112 (66.07%), Query Frame = 1
Query:  184 GSRNNDVPGLSCLSWRLGVETNNVIGWATVPEKCAGYVGHYMLGQQYRMDSEVVANEAILYAQSLKLAGDGKNIWVFDIDETSLSNLPYYAKNGFGVKPYNPTLFNEWVNTG 519
            G R+++V    C S+RL VE +N+  + T+PE+C      Y+ G+Q+R DS+ V  +A  YA   ++  +  +I++F ID T LSN+PYY K+G+GV+ +N TL++EWVN G
Sbjct:   35 GERSSEV---KCASFRLAVEAHNIRAFKTIPEECVEPTKDYINGEQFRSDSKTVNQQAFFYASEREVHHN--DIFIFGIDNTVLSNIPYYEKHGYGVEEFNETLYDEWVNKG 141          
The following BLAST results are available for this feature:
BLAST of CF504293 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 6
Match NameE-valueIdentityDescription
PPA1_SOLLC3.847e-2647.57Acid phosphatase 1 OS=Solanum lycopersicum GN=APS1... [more]
VSPA_SOYBN3.600e-2445.00Stem 28 kDa glycoprotein OS=Glycine max GN=VSPA PE... [more]
S25K_SOYBN3.600e-2445.00Stem 31 kDa glycoprotein (Fragment) OS=Glycine max... [more]
VSP1_ARATH3.048e-2338.85Vegetative storage protein 1 OS=Arabidopsis thalia... [more]
VSP2_ARATH3.981e-2346.60Vegetative storage protein 2 OS=Arabidopsis thalia... [more]
VSPB_SOYBN2.415e-2041.96Stem 31 kDa glycoprotein OS=Glycine max GN=VSPB PE... [more]
back to top
Properties
Property NameValue
Genbank descriptionUSDA-FP_119000-782 Immature Ovaries from field-collected Valencia Sweet Orange (Citrus sinensis (L.) Osbeck) Citrus sinensis cDNA clone MVF-16_F05 5, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF504293 ID=CF504293|Name=CF504293|organism=Citrus sinensis|type=EST|length=585bp
GTTGTAATGAGCATGGGAGGGGTGTCACTGCCATTATTCTTCTTTTTTCT
GGCTACCATATCAGCAACATCCCATGGATTTAGCATGGACATCCGCCATC
TTTTTCTGGCTACCATATCAGCAACATCCCATGGATTTAGCATGGACATC
CCCCATCAGATTCATCTTCTCCGACCGAAAGCCGGTTCCCGGAACAACGA
TGTTCCCGGCTTGTCCTGCCTGAGTTGGCGACTCGGAGTGGAAACTAATA
ACGTTATAGGATGGGCGACTGTTCCCGAAAAATGTGCAGGCTACGTGGGG
CATTACATGTTAGGCCAGCAGTACCGCATGGACTCTGAAGTGGTAGCTAA
TGAGGCCATTCTCTATGCGCAGAGCCTCAAGCTTGCTGGCGACGGCAAGA
ACATTTGGGTTTTCGACATAGATGAAACCTCGCTATCTAATTTGCCATAT
TATGCTAAGAATGGATTCGGGGTGAAGCCATACAACCCTACTTTGTTTAA
TGAATGGGTGAACACCGGAAAGCACCACCGCTGCCAGAGAGCCTTAAGCT
TTACAAAAAATTATTATTGCTTGGAATTAAAATTG
back to top