CF505043
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF505043 vs. ExPASy Swiss-Prot
Match: YPC1_YEAST (Alkaline ceramidase YPC1 OS=Saccharomyces cerevisiae GN=YPC1 PE=1 SV=1) HSP 1 Score: 60.077 bits (144), Expect = 3.434e-11 Identity = 29/53 (54.72%), Postives = 37/53 (69.81%), Query Frame = 1 Query: 337 WGPVTST-DWCEKNYVYSSYIAEFLNTLSNVPCILLALFGLINALRQRFEKRF 492 WG TST DWCE+NYV S YIAE+ NTL+N IL A++ +A + + EKRF Sbjct: 17 WGETTSTIDWCEENYVVSPYIAEWSNTLTNSVFILSAIYTTYSAYKNKLEKRF 69 HSP 2 Score: 26.9498 bits (58), Expect = 3.434e-11 Identity = 11/25 (44.00%), Postives = 17/25 (68.00%), Query Frame = 2 Query: 518 ILAIGSMLYHATLQHMQQQGDETPM 592 ++ +GS L+H TL++ Q DE PM Sbjct: 78 LVGVGSWLFHMTLKYRFQLLDELPM 102
BLAST of CF505043 vs. ExPASy Swiss-Prot
Match: ACER3_MOUSE (Alkaline ceramidase 3 OS=Mus musculus GN=Acer3 PE=2 SV=1) HSP 1 Score: 67.3958 bits (163), Expect = 6.388e-11 Identity = 29/54 (53.70%), Postives = 40/54 (74.07%), Query Frame = 1 Query: 334 FWGPVTST-DWCEKNYVYSSYIAEFLNTLSNVPCILLALFGLINALRQRFEKRF 492 +WGP TST DWCE+NYV + ++AEF NT+SN+ I+ +FG I +R R EKR+ Sbjct: 10 YWGPTTSTLDWCEENYVVTLFVAEFWNTVSNLIMIIPPIFGAIQGIRDRLEKRY 63 The following BLAST results are available for this feature:
BLAST of CF505043 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 2
Properties
Sequences
The
following sequences are available for this feature:
EST sequence >CF505043 ID=CF505043; Name=CF505043; organism=Citrus sinensis; type=EST; length=605bpback to top |