CF831921

Overview
NameCF831921
Unique NameCF831921
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length644
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
CF831921_ssr286 microsatellite CF831921_ssr286:286..297. BLAST: Citrus ESTs to Prunus persica proteins V1
Csv1_Contig13355 contig Csv1_Contig13355:173..816. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF831921 vs. ExPASy Swiss-Prot
Match: CC124_HUMAN (Coiled-coil domain-containing protein 124 OS=Homo sapiens GN=CCDC124 PE=1 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 4.662e-18
Identity = 47/100 (47.00%), Postives = 70/100 (70.00%), Query Frame = 2
Query:  281 TAEE-EEYERMVLVTNTNR---DESIIEARSVEEALDKMKVADNLPVDRHPERRLKASFKAFEEAELPRLKEEKPGLTHNQYKDMIWKLWKKSPDNPLNQ 568
            TAE+ + +  + L  N NR   +E  +EAR++E+A+  + VA+    DRHPERR++A+F AFEEA+LPRLK+E P +  +Q K ++ K W +SPDNP+NQ
Sbjct:  116 TAEKAKSHLEVPLEENVNRRVLEEGSVEARTIEDAIAVLSVAEEA-ADRHPERRMRAAFTAFEEAQLPRLKQENPNMRLSQLKQLLKKEWLRSPDNPMNQ 214          
BLAST of CF831921 vs. ExPASy Swiss-Prot
Match: CC124_BOVIN (Coiled-coil domain-containing protein 124 OS=Bos taurus GN=CCDC124 PE=2 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 4.662e-18
Identity = 46/99 (46.46%), Postives = 65/99 (65.66%), Query Frame = 2
Query:  272 HSRTAEEEEYERMVLVTNTNRDESIIEARSVEEALDKMKVADNLPVDRHPERRLKASFKAFEEAELPRLKEEKPGLTHNQYKDMIWKLWKKSPDNPLNQ 568
            H     EE   R VL      +E  +EAR++E+A+  + V +   VDRHPERR++A++ AFEEA+LPRLK+E P +  +Q K M+ K W +SPDNP+NQ
Sbjct:  123 HLEVPLEENVNRRVL------EEGSVEARTIEDAIAVLSVTEEA-VDRHPERRMRAAYTAFEEAQLPRLKQENPNMRLSQLKQMLKKEWLRSPDNPMNQ 214          
BLAST of CF831921 vs. ExPASy Swiss-Prot
Match: CC124_PONAB (Coiled-coil domain-containing protein 124 OS=Pongo abelii GN=CCDC124 PE=2 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.356e-17
Identity = 47/100 (47.00%), Postives = 69/100 (69.00%), Query Frame = 2
Query:  281 TAEE-EEYERMVLVTNTNR---DESIIEARSVEEALDKMKVADNLPVDRHPERRLKASFKAFEEAELPRLKEEKPGLTHNQYKDMIWKLWKKSPDNPLNQ 568
            TAE+ + +  + L  N NR   +E  +EAR++E+A+  + VA+    DRHPERR +A+F AFEEA+LPRLK+E P +  +Q K ++ K W +SPDNP+NQ
Sbjct:  116 TAEKAKSHLEVPLEENVNRRVLEEGSVEARTIEDAIAVLSVAEEA-ADRHPERRQRAAFTAFEEAQLPRLKQENPNMRLSQLKQLLKKEWLRSPDNPMNQ 214          
BLAST of CF831921 vs. ExPASy Swiss-Prot
Match: CC124_MOUSE (Coiled-coil domain-containing protein 124 OS=Mus musculus GN=Ccdc124 PE=2 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.314e-17
Identity = 44/88 (50.00%), Postives = 62/88 (70.45%), Query Frame = 2
Query:  314 LVTNTNR---DESIIEARSVEEALDKMKVADNLPVDRHPERRLKASFKAFEEAELPRLKEEKPGLTHNQYKDMIWKLWKKSPDNPLNQ 568
            L  N NR   +E  +EAR+VE+A+  + VA+    DRHPERR++A+F AFEE +LPRLK+E P +  +Q K ++ K W +SPDNP+NQ
Sbjct:  123 LEENLNRRLQEEGSVEARTVEDAIAVLSVAEE--ADRHPERRMRAAFTAFEEVQLPRLKQENPNMRLSQLKQLLKKEWLRSPDNPMNQ 208          
BLAST of CF831921 vs. ExPASy Swiss-Prot
Match: C124A_XENLA (Coiled-coil domain-containing protein 124-A OS=Xenopus laevis GN=ccdc124-A PE=2 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 6.732e-17
Identity = 47/103 (45.63%), Postives = 66/103 (64.08%), Query Frame = 2
Query:  272 HSRTAEEEE-YERMVLVTNTNR---DESIIEARSVEEALDKMKVADNLPVDRHPERRLKASFKAFEEAELPRLKEEKPGLTHNQYKDMIWKLWKKSPDNPLNQ 568
            H  T E+ + +  M L  N NR   +E  +EAR+VE+A+  + V   L  DRHPERR+KA+F AFEE  +P LK+E P +  +Q K ++ K W KSP+NP+NQ
Sbjct:  109 HKATTEKPKTHLEMPLEENVNRRVLEEGEVEARTVEDAIAALSVGKEL--DRHPERRMKAAFAAFEEINMPLLKQENPNMRLSQLKHLLKKEWMKSPENPMNQ 209          
BLAST of CF831921 vs. ExPASy Swiss-Prot
Match: CC124_DANRE (Coiled-coil domain-containing protein 124 OS=Danio rerio GN=ccdc124 PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.500e-16
Identity = 43/97 (44.33%), Postives = 65/97 (67.01%), Query Frame = 2
Query:  287 EEEEYERMVLVTNTNR---DESIIEARSVEEALDKMKVADNLPVDRHPERRLKASFKAFEEAELPRLKEEKPGLTHNQYKDMIWKLWKKSPDNPLNQ 568
            +E+ +  + L  N NR   +E  +EAR++E+A+  +   ++L  DRHPERR+KA++ AFEEA +PR+K E P +  +Q K  + K W KSP+NPLNQ
Sbjct:  114 KEKSHLDVPLEENVNRIVPEEGTVEARTIEDAIAVLSTKEDL--DRHPERRMKAAYTAFEEANMPRVKMENPNMRLSQLKQQLKKEWTKSPENPLNQ 208          
BLAST of CF831921 vs. ExPASy Swiss-Prot
Match: CC124_XENTR (Coiled-coil domain-containing protein 124 OS=Xenopus tropicalis GN=ccdc124 PE=2 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 1.959e-16
Identity = 43/99 (43.43%), Postives = 63/99 (63.64%), Query Frame = 2
Query:  272 HSRTAEEEEYERMVLVTNTNRDESIIEARSVEEALDKMKVADNLPVDRHPERRLKASFKAFEEAELPRLKEEKPGLTHNQYKDMIWKLWKKSPDNPLNQ 568
            H     EE   R +L      +E  +EAR+VE+A+  + ++  L  DRHPERR+KA+F AFEE  +PR+K+E P +  +Q K ++ K W KSP+NP+NQ
Sbjct:  119 HLEIPLEENLNRRIL------EEGEVEARTVEDAIAALSMSKEL--DRHPERRMKAAFTAFEEINMPRIKQENPNMRLSQLKQLLKKEWMKSPENPMNQ 209          
BLAST of CF831921 vs. ExPASy Swiss-Prot
Match: C124B_XENLA (Coiled-coil domain-containing protein 124-B OS=Xenopus laevis GN=ccdc124-B PE=2 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 4.364e-16
Identity = 44/99 (44.44%), Postives = 61/99 (61.62%), Query Frame = 2
Query:  272 HSRTAEEEEYERMVLVTNTNRDESIIEARSVEEALDKMKVADNLPVDRHPERRLKASFKAFEEAELPRLKEEKPGLTHNQYKDMIWKLWKKSPDNPLNQ 568
            H     EE   R VL      +E  +EAR+VE+A+  + +   L  DRHPERR+KA+F AFEE  +P LK+E P +  +Q K ++ K W KSP+NP+NQ
Sbjct:  119 HLEIPLEENVNRRVL------EEGEVEARTVEDAIAALSIGKEL--DRHPERRMKAAFTAFEEINMPLLKQENPNMRLSQLKQLLKKEWMKSPENPMNQ 209          
BLAST of CF831921 vs. ExPASy Swiss-Prot
Match: CC124_DICDI (Coiled-coil domain-containing protein 124 homolog OS=Dictyostelium discoideum GN=DDB_G0289893 PE=3 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 3.127e-14
Identity = 36/94 (38.30%), Postives = 56/94 (59.57%), Query Frame = 2
Query:  290 EEEYERMVLVTNTNRDESIIEARSVEEALDKMKVADNLPVDRHPERRLKASFKAFEEAELPRLKEEKPGLTHNQYKDMIWKLWKKSPDNPLNQI 571
            EE    ++        + +I+AR + EA+  +   D    ++HPERR+KA+F A+EE  LP L++E P L   Q K ++WK W K+P+NP NQ+
Sbjct:  153 EENMNHILREQRLKDGKDVIDARDINEAIGALSGNDGK--EQHPERRMKAAFNAYEEENLPVLRKENPSLRLTQVKQLLWKNWLKAPENPFNQV 244          
BLAST of CF831921 vs. ExPASy Swiss-Prot
Match: CC124_SCHPO (Coiled-coil domain-containing protein 124 homolog OS=Schizosaccharomyces pombe GN=SPBC29A10.12 PE=2 SV=1)

HSP 1 Score: 74.7146 bits (182), Expect = 4.516e-13
Identity = 32/76 (42.11%), Postives = 57/76 (75.00%), Query Frame = 2
Query:  353 ARSVEEALDKMKVADNLP---VDRHPERRLKASFKAFEEAELPRLKEEKPGLTHNQYKDMIWKLWKKSPDNPLNQI 571
            AR++++ALD + + ++     +DRHPERR KA+   ++++ LP L++E+PGL  NQY+D+++K ++K PDNP N++
Sbjct:  104 ARNIDDALDLLSLNNSSSKDKIDRHPERRFKAALTEYKQSRLPELRKEQPGLRLNQYEDIMYKEFQKHPDNPFNKM 179          
The following BLAST results are available for this feature:
BLAST of CF831921 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 10
Match NameE-valueIdentityDescription
CC124_HUMAN4.662e-1847.00Coiled-coil domain-containing protein 124 OS=Homo ... [more]
CC124_BOVIN4.662e-1846.46Coiled-coil domain-containing protein 124 OS=Bos t... [more]
CC124_PONAB1.356e-1747.00Coiled-coil domain-containing protein 124 OS=Pongo... [more]
CC124_MOUSE2.314e-1750.00Coiled-coil domain-containing protein 124 OS=Mus m... [more]
C124A_XENLA6.732e-1745.63Coiled-coil domain-containing protein 124-A OS=Xen... [more]
CC124_DANRE1.500e-1644.33Coiled-coil domain-containing protein 124 OS=Danio... [more]
CC124_XENTR1.959e-1643.43Coiled-coil domain-containing protein 124 OS=Xenop... [more]
C124B_XENLA4.364e-1644.44Coiled-coil domain-containing protein 124-B OS=Xen... [more]
CC124_DICDI3.127e-1438.30Coiled-coil domain-containing protein 124 homolog ... [more]
CC124_SCHPO4.516e-1342.11Coiled-coil domain-containing protein 124 homolog ... [more]
back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01A06_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01A06, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF831921 ID=CF831921|Name=CF831921|organism=Citrus sinensis|type=EST|length=644bp
CTGGCGCGAACCCGTTGGAGCAAAGTCACGCGCCGCGAAGAAACGCGAGG
AGGAAGCCGAGAAGCGAGCCGAAGCCGCCGCGAAGAAAGCGGAGGCGCGG
CGCCTGGCGGAGTTGGAGGAGAAAGAGCTCGAAAAGGCTATGAAAAAGCC
GGACAAGAAAGCGAACAGGGTTTCGATTCCGGTACCGAAGGTGACGGAGG
CTGATCTGCGGAAGAGGCGCGAGCAGGAGCAGGCGGAGTTGGCGAAGAAG
GCGGAGGAGGCGAAAAAGAAGCACAGCAGGACGGCGGAGGAGGAGGAGTA
TGAGCGGATGGTTTTGGTGACGAATACGAATCGTGATGAGTCGATTATCG
AGGCCAGGAGCGTTGAGGAGGCTTTAGATAAGATGAAGGTGGCGGATAAC
TTGCCGGTCGATAGGCATCCAGAACGACGGCTGAAGGCGTCCTTTAAGGC
TTTTGAAGAAGCTGAGCTCCCCAGGCTGAAGGAAGAGAAACCAGGTCTTA
CTCACAATCAATACAAGGACATGATATGGAAGCTTTGGAAGAAATCTCCA
GACAATCCTCTCAATCAGATTACGGAGTGAGCATCCTACATTGCATTGTT
TGGATCTTCAAGGTGGTGTATCAAGCGAGTTCTCTGTGGGGCAC
back to top