CF831925

Overview
NameCF831925
Unique NameCF831925
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length778
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig1911 contig Csv1_Contig1911:289..1066. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF831925 vs. ExPASy Swiss-Prot
Match: PER3_ARATH (Peroxidase 3 OS=Arabidopsis thaliana GN=PER3 PE=1 SV=1)

HSP 1 Score: 282.722 bits (722), Expect = 1.512e-75
Identity = 150/255 (58.82%), Postives = 188/255 (73.73%), Query Frame = 3
Query:   21 PDLPAKLIRMHFHDCFVRGCDASVLINSTAGNKAERDAVPNLSLGGFEVINEIKSELESSCPGIVSCADIVALATRDSVSFQFQKPDLWEVLTGRRDGSVSIAAEADLLLPSPFANFSELKKNFNDKGLTVKDLVVLSGGHTIGVSHCTFFSNRLYNFTGNGDQDPSLDPRYAAFLKT-KCKSLADTTTTAELDPGSFRKFDSHYYDILIENKGLFQSDAALLTNKGARNIVMEL--RNQDKFFTEFAQSMKRMG 776
            P L A LIRMHFHDCFVRGCD SVLINST+GN AERDA PNL++ GF  I+ IKS LE+ CPGIVSCADI+ALA+RD+V F    P+ W V TGRRDG +S AAEA   +P P +N + L+  F ++GL +KDLV+LSG HTIGVSHC+ F+NRLYNFTG G QDP+LD  YAA LK+ KC SL D  T  E+DPGS + FD  YY ++++ +GLFQSD+AL TN    + +  +   +   FF+EFA+SM++MG
Sbjct:   54 PSLAAALIRMHFHDCFVRGCDGSVLINSTSGN-AERDATPNLTVRGFGFIDAIKSVLEAQCPGIVSCADIIALASRDAVVFT-GGPN-WSVPTGRRDGRISNAAEALANIPPPTSNITNLQTLFANQGLDLKDLVLLSGAHTIGVSHCSSFTNRLYNFTGRGGQDPALDSEYAANLKSRKCPSLNDNKTIVEMDPGSRKTFDLSYYQLVLKRRGLFQSDSALTTNPTTLSNINRILTGSVGSFFSEFAKSMEKMG 305          
BLAST of CF831925 vs. ExPASy Swiss-Prot
Match: PER39_ARATH (Peroxidase 39 OS=Arabidopsis thaliana GN=PER39 PE=1 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 1.848e-73
Identity = 146/256 (57.03%), Postives = 183/256 (71.48%), Query Frame = 3
Query:   21 PDLPAKLIRMHFHDCFVRGCDASVLINSTAGNK-AERDAVPNLSLGGFEVINEIKSELESSCPGIVSCADIVALATRDSVSFQFQKPDLWEVLTGRRDGSVSIAAEADLLLPSPFANFSELKKNFNDKGLTVKDLVVLSGGHTIGVSHCTFFSNRLYNFTGNGDQDPSLDPRYAAFLKT-KCKSLADTTTTAELDPGSFRKFDSHYYDILIENKGLFQSDAALLTNKGARNIVMELR--NQDKFFTEFAQSMKRMG 776
            P L A LIRMHFHDCFVRGCD S+LIN+T+ N+  E+ A PNL++ GF+ I+++KS LES CPGIVSCADI+ LATRDS+      P  W V TGRRDG +S  AEA   +P PF NF+ L   F ++GL VKDLV+LSG HTIGVSHC+ FSNRL+NFTG GDQDPSLD  YA  LK+ +C S+AD TT  E+DPGS   FD  YY ++++ +GLF+SDAAL  N  A   V      ++ +FF EF+ SM++MG
Sbjct:   53 PSLAAGLIRMHFHDCFVRGCDGSILINATSSNQQVEKLAPPNLTVRGFDFIDKVKSALESKCPGIVSCADIITLATRDSI-VAIGGPT-WNVPTGRRDGRISNFAEAMNNIPPPFGNFTTLITLFGNQGLDVKDLVLLSGAHTIGVSHCSSFSNRLFNFTGVGDQDPSLDSEYADNLKSRRCLSIADNTTKVEMDPGSRNTFDLSYYRLVLKRRGLFESDAALTMNPAALAQVKRFAGGSEQEFFAEFSNSMEKMG 306          
BLAST of CF831925 vs. ExPASy Swiss-Prot
Match: PER30_ARATH (Peroxidase 30 OS=Arabidopsis thaliana GN=PER30 PE=1 SV=1)

HSP 1 Score: 270.011 bits (689), Expect = 1.014e-71
Identity = 143/255 (56.08%), Postives = 178/255 (69.80%), Query Frame = 3
Query:   21 PDLPAKLIRMHFHDCFVRGCDASVLINSTAGNKAERDAVPNLSLGGFEVINEIKSELESSCPGIVSCADIVALATRDSVSFQFQKPDLWEVLTGRRDGSVSIAAEADLLLPSPFANFSELKKNFNDKGLTVKDLVVLSGGHTIGVSHCTFFSNRLYNFTGNGDQDPSLDPRYAAFLK-TKCKSLADTTTTAELDPGSFRKFDSHYYDILIENKGLFQSDAALLTNKGARNIVMELRN--QDKFFTEFAQSMKRMG 776
            P L A LIRMHFHDCFVRGCD SVLINST+GN AERDA PNL+L GF  +  IK+ LE  CP  VSCADI+AL  RD+V         W V TGRRDG +S   EA   +P P +NF+ L++ F ++GL +KDLV+LSG HTIGVSHC+  + RLYNF+    QDPSLD +YAA LK  KCKSL D +T  E+DPGS R FD  YY ++++ +GLFQSD+AL TN     ++ +L N  + KFF  FA+SM++MG
Sbjct:   57 PSLAAPLIRMHFHDCFVRGCDGSVLINSTSGN-AERDAPPNLTLRGFGFVERIKALLEKVCPKTVSCADIIALTARDAVVATGGPS--WSVPTGRRDGRISNKTEATNNIPPPTSNFTTLQRLFKNQGLNLKDLVLLSGAHTIGVSHCSSMNTRLYNFSTTVKQDPSLDSQYAANLKANKCKSLNDNSTILEMDPGSSRSFDLSYYRLVLKRRGLFQSDSALTTNSATLKVINDLVNGSEKKFFKAFAKSMEKMG 308          
BLAST of CF831925 vs. ExPASy Swiss-Prot
Match: PER24_ARATH (Peroxidase 24 OS=Arabidopsis thaliana GN=PER24 PE=2 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 5.563e-70
Identity = 140/261 (53.64%), Postives = 179/261 (68.58%), Query Frame = 3
Query:    3 KNAAINPDLPAKLIRMHFHDCFVRGCDASVLINSTAGNK-AERDAVPNLSLGGFEVINEIKSELESSCPGIVSCADIVALATRDSVSFQFQKPDLWEVLTGRRDGSVSIAAEADLLLPSPFANFSELKKNFNDKGLTVKDLVVLSGGHTIGVSHCTFFSNRLYNFTGNGDQDPSLDPRYAAFLKTKC--KSL-ADTTTTAELDPGSFRKFDSHYYDILIENKGLFQSDAALLTNKGARNIVMELRNQDKFFTEFAQSMKRM 773
            K    N  L  KL+R+H+HDCFVRGCDAS+L++S AG   +E++A PNLSL GFE+I+EIK  LE  CP  VSCADI+ LA RD+VS++F++P LW V TGR DG VS+A EA   LPS  ANF+ L+K F +  L V DLV LSG HTIG++HC  F  RL NFTG GD DPSL+P YA+FLK++C  KSL  + +    +DP     FDS Y+  L++NKGLF SDAALLT+  A +I    +N   F  +F +SM +M
Sbjct:   68 KKVEANRSLAPKLLRVHYHDCFVRGCDASLLLDSVAGKAVSEKEARPNLSLSGFEIIDEIKYILEKRCPNTVSCADILTLAARDAVSYEFERP-LWNVFTGRVDGRVSLATEAARDLPSAGANFTTLQKLFAESDLDVVDLVALSGAHTIGIAHCGVFGRRLLNFTGKGDTDPSLNPSYASFLKSECSDKSLRLNPSAVVGMDPTGPLAFDSGYFVSLLKNKGLFTSDAALLTDPSAAHIASVFQNSGAFLAQFGRSMIKM 327          
BLAST of CF831925 vs. ExPASy Swiss-Prot
Match: PER27_ARATH (Peroxidase 27 OS=Arabidopsis thaliana GN=PER27 PE=1 SV=1)

HSP 1 Score: 263.848 bits (673), Expect = 7.266e-70
Identity = 140/254 (55.12%), Postives = 174/254 (68.50%), Query Frame = 3
Query:   21 PDLPAKLIRMHFHDCFVRGCDASVLINSTAGNKAERDAVPNLSLGGFEVINEIKSELESSCPGIVSCADIVALATRDSVSFQFQKPDLWEVLTGRRDGSVSIAAEADLLLPSPFANFSELKKNFNDKGLTVKDLVVLSGGHTIGVSHCTFFSNRLYNFTGNGDQDPSLDPRYAAFLKTKCKSLADTTTTAELDPGSFRKFDSHYYDILIENKGLFQSDAALLTNKGARNIVME--LRNQDKFFTEFAQSMKRMG 776
            P L A L+RM FHDCFVRGCD SVL++    N+ E+ AVPNLSL GF +I++ K+ LE  CPGIVSC+DI+AL  RD++    + P  WEV TGRRDG VS   E +L  PSPF N ++L  +F  KGL  KDLV+LSGGHTIG+ HC   +NRLYNFTG GD DPSLD  YAA L+ KCK   DTTT  E+DPGSF+ FD  Y+ ++ + +GLFQSDAALL N   R  V++    +   FF +F  SM +MG
Sbjct:   54 PTLGAPLLRMFFHDCFVRGCDGSVLLDKP-NNQGEKSAVPNLSLRGFGIIDDSKAALEKVCPGIVSCSDILALVARDAM-VALEGPS-WEVETGRRDGRVSNINEVNL--PSPFDNITKLISDFRSKGLNEKDLVILSGGHTIGMGHCPLLTNRLYNFTGKGDSDPSLDSEYAAKLRKKCKP-TDTTTALEMDPGSFKTFDLSYFTLVAKRRGLFQSDAALLDNSKTRAYVLQQIRTHGSMFFNDFGVSMVKMG 301          
BLAST of CF831925 vs. ExPASy Swiss-Prot
Match: PER56_ARATH (Peroxidase 56 OS=Arabidopsis thaliana GN=PER56 PE=2 SV=1)

HSP 1 Score: 261.922 bits (668), Expect = 2.761e-69
Identity = 136/252 (53.97%), Postives = 172/252 (68.25%), Query Frame = 3
Query:   27 LPAKLIRMHFHDCFVRGCDASVLINSTAGNKAERDAVPNLSLGGFEVINEIKSELESSCPGIVSCADIVALATRDSVSFQFQKPDLWEVLTGRRDGSVSIAAEADLLLPSPFANFSELKKNFNDKGLTVKDLVVLSGGHTIGVSHCTFFSNRLYNFTGNGDQDPSLDPRYAAFLKTKCKSLADTTTTAELDPGSFRKFDSHYYDILIENKGLFQSDAALLTNKGARNIVMELRNQD--KFFTEFAQSMKRMG 776
            + A L+RM FHDCFVRGC+ SVL+      K E++++PNL+L GFE+I+ +K+ LE  CPGIVSC+D++AL  RD++      P  WEV TGRRDG V+   EA L LPSPF N S L   F  KGL  KDLVVLSGGHTIG  HC   +NRLYNFTG GD DP+LD  YA  L+ KCK   DTTT  E+DPGSF+ FD  Y+ ++ + +GLFQSDAALL N+  ++ V++  N D   FF +F  SM +MG
Sbjct:   62 IAAPLLRMFFHDCFVRGCEGSVLLE-LKNKKDEKNSIPNLTLRGFEIIDNVKAALEKECPGIVSCSDVLALVARDAM-VALNGPS-WEVETGRRDGLVTNITEALLNLPSPFNNISSLITQFQSKGLDKKDLVVLSGGHTIGNGHCPQITNRLYNFTGKGDSDPNLDTEYAVKLRGKCKP-TDTTTALEMDPGSFKTFDESYFKLVSQRRGLFQSDAALLDNQETKSYVLKSLNSDGSTFFKDFGVSMVKMG 309          
BLAST of CF831925 vs. ExPASy Swiss-Prot
Match: PER1_ORYSJ (Peroxidase 1 OS=Oryza sativa subsp. japonica GN=PRX74 PE=2 SV=2)

HSP 1 Score: 253.832 bits (647), Expect = 7.519e-67
Identity = 135/258 (52.33%), Postives = 169/258 (65.50%), Query Frame = 3
Query:   21 PDLPAKLIRMHFHDCFVRGCDASVLINSTAGNKAERDAVPNLSLGGFEVINEIKSELESSCPGIVSCADIVALATRDSVSFQFQKPDLWEVLTGRRDGSVSIAAEADLLLPSPFANFSELKKNFNDKGLTVKDLVVLSGGHTIGVSHCTFFSNRLYNFTG---NGDQDPSLDPRYAAFLKTKCKSLADTTTTAELDPGSFRKFDSHYYDILIENKGLFQSDAALLTNKGARNIVMELRN---QDKFFTEFAQSMKRMG 776
            P L   L+RMHFHDCFVRGCD SVL++S   + AE+DA PN +L GF  +  +K+ +E +CPG VSCAD++AL  RD+V     K   W V  GRRDG VSIA E D  LP P ANF+EL + F  K L +KDLVVLS GHTIG SHC  F++RLYNFTG     D DP+L+ +Y A L++KC SL D TT  E+DPGSF+ FD  Y+  + + +GLF SD  LLTN   R  V        +D+FF +FA SM +MG
Sbjct:   52 PSLAGPLLRMHFHDCFVRGCDGSVLLDSAGNSTAEKDATPNQTLRGFGFVERVKAAVEKACPGTVSCADVLALMARDAV--WLSKGPFWAVPLGRRDGRVSIANETD-QLPPPTANFTELTQMFAAKNLDLKDLVVLSAGHTIGTSHCFSFTDRLYNFTGLDNAHDIDPTLELQYMARLRSKCTSLQDNTTLVEMDPGSFKTFDLGYFKNVAKRRGLFHSDGELLTNGFTRAYVQRHAGGGYKDEFFADFAASMVKMG 306          
BLAST of CF831925 vs. ExPASy Swiss-Prot
Match: PER1_ARATH (Peroxidase 1/2 OS=Arabidopsis thaliana GN=PER1 PE=1 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 3.732e-66
Identity = 132/254 (51.97%), Postives = 169/254 (66.54%), Query Frame = 3
Query:   27 LPAKLIRMHFHDCFVRGCDASVLINSTAGNKAERDAVPNLSLGGFEVINEIKSELESSCPGIVSCADIVALATRDSVSFQFQKPDLWEVLTGRRDGSVSIAAEADLLLPSPFANFSELKKNFNDKGLTVKDLVVLSGGHTIGVSHCTFFSNRLYNFTGNGDQDPSLDPRYAAFLKTKCKSLADTTTTAELDPGSFRKFDSHYYDILIENKGLFQSDAALLTNKGARNIVMELRNQDKFFT----EFAQSMKRMG 776
            L AKL+RMHFHDCFVRGCD SVL+ S A N AERDAVPNL+L G+EV++  K+ LE  CP ++SCAD++AL  RD+V+        W V  GRRDG +S   +A L LPSPFA+   LKKNF +KGL  KDLVVLSGGHTIG+S C   ++RLYNFTG GD DPS++P Y   LK KC    D  T+  +DPGS   FD+HY+ ++ + KGLF SD+ LL +   +N V         F+    +F+ SM ++G
Sbjct:   56 LAAKLLRMHFHDCFVRGCDGSVLLKS-AKNDAERDAVPNLTLKGYEVVDAAKTALERKCPNLISCADVLALVARDAVAVI--GGPWWPVPLGRRDGRISKLNDALLNLPSPFADIKTLKKNFANKGLNAKDLVVLSGGHTIGISSCALVNSRLYNFTGKGDSDPSMNPSYVRELKRKCPP-TDFRTSLNMDPGSALTFDTHYFKVVAQKKGLFTSDSTLLDDIETKNYVQTQAILPPVFSSFNKDFSDSMVKLG 305          
BLAST of CF831925 vs. ExPASy Swiss-Prot
Match: PER5_VITVI (Peroxidase 5 OS=Vitis vinifera GN=GSVIVT00037159001 PE=1 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 8.333e-58
Identity = 124/249 (49.80%), Postives = 160/249 (64.26%), Query Frame = 3
Query:   39 LIRMHFHDCFVRGCDASVLINSTAGNKAERDA-VPNLSLGGFEVINEIKSELESSCPGIVSCADIVALATRDSVSFQFQKPDLWEVLTGRRDGSVSIAAEADLLLPSPFANFSELKKNFNDKGLTVKDLVVLSGGHTIGVSHCTFFSNRLYNFTGNGDQDPSLDPRYAAFLKTKC-KSLADTTTTAELDPGSFRKFDSHYYDILIENKGLFQSDAALLTN-KGARNIVMELRNQDKFFTEFAQSMKRMG 776
            L+RMHFHDCFVRGCD SVLI+ST  N AE+D+   N SL GFEVI+  K+ LE+ C G+VSCADIVA A RDSV         ++V  GRRDG +S+A+EA   LP P     +L + F++KGLT  ++V LSG HTIG SHC+ FSNRLYNF G   QDP+LDP+YAA LKT+C +   +T     ++P S    D  YY  ++ N+GLF SD  LLT+   A  +     N   +  +FA +M +MG
Sbjct:   95 LVRMHFHDCFVRGCDGSVLIDSTPSNTAEKDSPANNPSLRGFEVIDSAKARLEAVCKGVVSCADIVAFAARDSVEITGGLG--YDVPAGRRDGRISLASEASTNLPPPTFTVDQLTQFFSNKGLTQDEMVTLSGAHTIGRSHCSSFSNRLYNFNGTSGQDPTLDPQYAASLKTQCPQGSTNTNLVVPMNPSSPSITDVGYYVDVLRNRGLFTSDQTLLTDTTTATQVRQNAGNPFLWKNKFASAMVKMG 341          
BLAST of CF831925 vs. ExPASy Swiss-Prot
Match: PER64_ARATH (Peroxidase 64 OS=Arabidopsis thaliana GN=PER64 PE=1 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 1.203e-56
Identity = 115/250 (46.00%), Postives = 157/250 (62.80%), Query Frame = 3
Query:   27 LPAKLIRMHFHDCFVRGCDASVLINSTAGNKAERDAVPNLSLGGFEVINEIKSELESSCPGIVSCADIVALATRDSVSFQFQKPDLWEVLTGRRDGSVSIAAEADLLLPSPFANFSELKKNFNDKGLTVKDLVVLSGGHTIGVSHCTFFSNRLYNFTGNGDQDPSLDPRYAAFLKTKCKSLADTTTTAELDPGSFRKFDSHYYDILIENKGLFQSDAALLTNKGARNIVMELRN-QDKFFTEFAQSMKRM 773
            +PA L+RMHFHDCFVRGCD SVL++S   NKAE+D  PN+SL  F VI+  K  LE  CPGIVSCADI++LA RD+V+        W V  GR+DG +S A E    LP+P  N S+L++NF  +GL++ DLV LSGGHT+G +HC+ F NRL+ F    + DP+L+P +AA L+  C +            G+   FD+ YY +LI+ K LF SD +LL     + +V +  N  ++F   F +SM +M
Sbjct:   53 VPAALLRMHFHDCFVRGCDGSVLLDSKGKNKAEKDGPPNISLHAFYVIDNAKKALEEQCPGIVSCADILSLAARDAVA--LSGGPTWAVPKGRKDGRISKAIET-RQLPAPTFNISQLRQNFGQRGLSMHDLVALSGGHTLGFAHCSSFQNRLHKFNTQKEVDPTLNPSFAARLEGVCPAHNTVKNAGSNMDGTVTSFDNIYYKMLIQGKSLFSSDESLLAVPSTKKLVAKYANSNEEFERAFVKSMIKM 299          
The following BLAST results are available for this feature:
BLAST of CF831925 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 110
Match NameE-valueIdentityDescription
PER3_ARATH1.512e-7558.82Peroxidase 3 OS=Arabidopsis thaliana GN=PER3 PE=1 ... [more]
PER39_ARATH1.848e-7357.03Peroxidase 39 OS=Arabidopsis thaliana GN=PER39 PE=... [more]
PER30_ARATH1.014e-7156.08Peroxidase 30 OS=Arabidopsis thaliana GN=PER30 PE=... [more]
PER24_ARATH5.563e-7053.64Peroxidase 24 OS=Arabidopsis thaliana GN=PER24 PE=... [more]
PER27_ARATH7.266e-7055.12Peroxidase 27 OS=Arabidopsis thaliana GN=PER27 PE=... [more]
PER56_ARATH2.761e-6953.97Peroxidase 56 OS=Arabidopsis thaliana GN=PER56 PE=... [more]
PER1_ORYSJ7.519e-6752.33Peroxidase 1 OS=Oryza sativa subsp. japonica GN=PR... [more]
PER1_ARATH3.732e-6651.97Peroxidase 1/2 OS=Arabidopsis thaliana GN=PER1 PE=... [more]
PER5_VITVI8.333e-5849.80Peroxidase 5 OS=Vitis vinifera GN=GSVIVT0003715900... [more]
PER64_ARATH1.203e-5646.00Peroxidase 64 OS=Arabidopsis thaliana GN=PER64 PE=... [more]

Pages

back to top
Properties
Property NameValue
Genbank descriptionUCRCS02_01A09_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01A09, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF831925 ID=CF831925|Name=CF831925|organism=Citrus sinensis|type=EST|length=778bp
GGAAAAATGCCGCCATTAACCCTGACTTGCCGGCCAAGCTTATCAGAATG
CATTTCCATGACTGCTTTGTTAGGGGTTGCGATGCGTCGGTTTTGATAAA
CTCAACTGCAGGTAACAAAGCAGAGAGGGATGCAGTTCCGAATCTATCTT
TGGGAGGTTTCGAAGTTATTAATGAGATTAAATCGGAGCTCGAGAGCAGT
TGTCCAGGAATTGTTTCTTGTGCCGATATCGTAGCATTGGCTACAAGGGA
TTCTGTTTCATTCCAATTTCAAAAACCGGACCTGTGGGAAGTGCTCACCG
GTAGAAGAGATGGCAGTGTGTCCATAGCTGCTGAGGCCGATCTGCTGCTT
CCTTCACCTTTTGCCAACTTCAGTGAACTCAAGAAAAATTTTAACGACAA
AGGTCTCACTGTCAAAGATCTTGTAGTCCTTTCAGGTGGCCACACAATCG
GAGTTTCGCACTGCACCTTCTTCAGCAACAGGCTCTACAATTTCACAGGA
AATGGAGATCAAGATCCTTCATTGGACCCACGATACGCTGCATTCTTAAA
AACCAAATGCAAGAGCCTTGCCGACACAACGACTACTGCCGAATTGGACC
CGGGGAGTTTTCGAAAATTCGACAGCCATTACTATGATATTCTTATCGAG
AACAAGGGTCTATTCCAATCTGATGCTGCTCTTTTAACCAATAAGGGAGC
AAGAAACATTGTCATGGAGTTGAGAAACCAAGATAAGTTCTTCACCGAGT
TTGCTCAGTCAATGAAGAGAATGGGAGC
back to top