CF832072

Overview
NameCF832072
Unique NameCF832072
TypeEST
OrganismCitrus sinensis (Sweet orange)
Sequence length618
Analyses
This EST is derived from or has results from the following analyses
Analysis NameDate Performed
BLAST: Citrus ESTs to Prunus persica proteins V12010-05-10
BLAST: Citrus ESTs to Populus V2 proteins2010-05-10
BLAST: Citrus ESTs to TAIR92010-05-10
BLAST: Citrus ESTs to SwissProt2010-05-10
Alignments
Feature NameTypeLocationAnalysis
Csv1_Contig10238 contig Csv1_Contig10238:1066..1682. BLAST: Citrus Unigene V1 Contigs to Prunus persica proteins V1
Homology
BLAST of CF832072 vs. ExPASy Swiss-Prot
Match: KSG7_ARATH (Shaggy-related protein kinase eta OS=Arabidopsis thaliana GN=ASK7 PE=1 SV=2)

HSP 1 Score: 110.538 bits (275), Expect = 4.757e-32
Identity = 51/61 (83.61%), Postives = 57/61 (93.44%), Query Frame = 3
Query:    3 QRMPSEAIDLASRLMQHSPSLQ*TALEACAHPFFDELREPNARLPNGRPLPPLFNFKQELS 185
            +RMP EAID ASRL+Q+SPSL+ TALEACAHPFFDELREPNARLPNGRP PPLFNFKQE++
Sbjct:  291 KRMPPEAIDFASRLLQYSPSLRCTALEACAHPFFDELREPNARLPNGRPFPPLFNFKQEVA 351          

HSP 2 Score: 48.1358 bits (113), Expect = 4.757e-32
Identity = 22/28 (78.57%), Postives = 26/28 (92.86%), Query Frame = 1
Query:  190 ASPELVNKLIPDHGKRQLGLNFLHPAGT 273
            +SPELVNKLIPDH KRQLGL+FL+ +GT
Sbjct:  353 SSPELVNKLIPDHIKRQLGLSFLNQSGT 380          
BLAST of CF832072 vs. ExPASy Swiss-Prot
Match: KSG6_ARATH (Shaggy-related protein kinase zeta OS=Arabidopsis thaliana GN=ASK6 PE=1 SV=2)

HSP 1 Score: 114.005 bits (284), Expect = 4.547e-29
Identity = 54/61 (88.52%), Postives = 59/61 (96.72%), Query Frame = 3
Query:    3 QRMPSEAIDLASRLMQHSPSLQ*TALEACAHPFFDELREPNARLPNGRPLPPLFNFKQELS 185
            +RMP EAIDLASRL+Q+SPSL+ TALEACAHPFF+ELREPNARLPNGRPLPPLFNFKQELS
Sbjct:  323 KRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFNELREPNARLPNGRPLPPLFNFKQELS 383          

HSP 2 Score: 34.6538 bits (78), Expect = 4.547e-29
Identity = 15/27 (55.56%), Postives = 20/27 (74.07%), Query Frame = 1
Query:  190 ASPELVNKLIPDHGKRQLGLNFLHPAG 270
            ASPEL+N+LIP+H +RQ+   F   AG
Sbjct:  385 ASPELINRLIPEHVRRQMNGGFPFQAG 411          
BLAST of CF832072 vs. ExPASy Swiss-Prot
Match: KSG9_ARATH (Shaggy-related protein kinase iota OS=Arabidopsis thaliana GN=ASK9 PE=2 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 8.891e-27
Identity = 53/60 (88.33%), Postives = 58/60 (96.67%), Query Frame = 3
Query:    3 QRMPSEAIDLASRLMQHSPSLQ*TALEACAHPFFDELREPNARLPNGRPLPPLFNFKQEL 182
            +RMP EAIDLASRL+Q+SPSL+ TALEACAHPFF+ELREPNARLPNGRPLPPLFNFKQEL
Sbjct:  321 KRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFNELREPNARLPNGRPLPPLFNFKQEL 380          

HSP 2 Score: 28.4906 bits (62), Expect = 8.891e-27
Identity = 11/18 (61.11%), Postives = 16/18 (88.89%), Query Frame = 1
Query:  190 ASPELVNKLIPDHGKRQL 243
            AS EL+N+LIP+H +RQ+
Sbjct:  383 ASMELINRLIPEHVRRQM 400          
BLAST of CF832072 vs. ExPASy Swiss-Prot
Match: KSG10_ARATH (Shaggy-related protein kinase kappa OS=Arabidopsis thaliana GN=ASK10 PE=1 SV=2)

HSP 1 Score: 95.5153 bits (236), Expect = 1.623e-21
Identity = 45/62 (72.58%), Postives = 52/62 (83.87%), Query Frame = 3
Query:    3 QRMPSEAIDLASRLMQHSPSLQ*TALEACAHPFFDELREPNARLPNGRPLPPLFNFK-QELS 185
            +R+P EA+DL  R  Q+SP+L+ TALEAC HP FDELR+PN RLPNGRPLPPLFNFK QELS
Sbjct:  334 KRLPPEAVDLLCRFFQYSPNLRCTALEACIHPLFDELRDPNTRLPNGRPLPPLFNFKPQELS 395          

HSP 2 Score: 27.7202 bits (60), Expect = 1.623e-21
Identity = 10/22 (45.45%), Postives = 16/22 (72.73%), Query Frame = 1
Query:  196 PELVNKLIPDHGKRQLGLNFLH 261
            PE+VN+L+P+H ++Q     LH
Sbjct:  399 PEIVNRLVPEHARKQNLFMALH 420          
BLAST of CF832072 vs. ExPASy Swiss-Prot
Match: KSG5_ARATH (Shaggy-related protein kinase epsilon OS=Arabidopsis thaliana GN=ASK5 PE=2 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.732e-20
Identity = 44/61 (72.13%), Postives = 52/61 (85.25%), Query Frame = 3
Query:    3 QRMPSEAIDLASRLMQHSPSLQ*TALEACAHPFFDELREPNARLPNGRPLPPLFNFK-QEL 182
            +R P EA+DL SRL+Q+SP+L+ TA+EA  HPFFDELR+PN RLPNGR LPPLFNFK QEL
Sbjct:  325 KRTPPEAVDLVSRLLQYSPNLRSTAMEAIVHPFFDELRDPNTRLPNGRALPPLFNFKPQEL 385          

HSP 2 Score: 27.335 bits (59), Expect = 1.732e-20
Identity = 11/17 (64.71%), Postives = 15/17 (88.24%), Query Frame = 1
Query:  190 ASPELVNKLIPDHGKRQ 240
            AS EL++KLIPDH ++Q
Sbjct:  388 ASLELLSKLIPDHARKQ 404          
BLAST of CF832072 vs. ExPASy Swiss-Prot
Match: KSG4_ARATH (Shaggy-related protein kinase delta OS=Arabidopsis thaliana GN=ASK4 PE=2 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 3.477e-20
Identity = 46/62 (74.19%), Postives = 54/62 (87.10%), Query Frame = 3
Query:    3 QRMPSEAIDLASRLMQHSPSLQ*TALEACAHPFFDELREPNARLPNGRPLPPLFNFK-QELS 185
            +R+P EA+DL  R  Q+SP+L+ TA+EAC HPFFDELR+PNARLPNGRPLPPLFNFK QELS
Sbjct:  333 KRLPPEAVDLLCRFFQYSPNLRCTAVEACIHPFFDELRDPNARLPNGRPLPPLFNFKPQELS 394          
BLAST of CF832072 vs. ExPASy Swiss-Prot
Match: KSG8_ARATH (Shaggy-related protein kinase theta OS=Arabidopsis thaliana GN=ASK8 PE=2 SV=3)

HSP 1 Score: 95.5153 bits (236), Expect = 2.254e-19
Identity = 45/62 (72.58%), Postives = 54/62 (87.10%), Query Frame = 3
Query:    3 QRMPSEAIDLASRLMQHSPSLQ*TALEACAHPFFDELREPNARLPNGRPLPPLFNF-KQELS 185
            +RMP EA+DL SRL+Q+SP+L+ TALEACAHPFFD+LR+PN  LPNGR LPPLFNF  QEL+
Sbjct:  389 KRMPPEAVDLVSRLLQYSPNLRCTALEACAHPFFDDLRDPNVSLPNGRALPPLFNFTAQELA 450          
BLAST of CF832072 vs. ExPASy Swiss-Prot
Match: MSK2_MEDSA (Glycogen synthase kinase-3 homolog MsK-2 OS=Medicago sativa GN=MSK-2 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 2.399e-19
Identity = 43/57 (75.44%), Postives = 50/57 (87.72%), Query Frame = 3
Query:    3 QRMPSEAIDLASRLMQHSPSLQ*TALEACAHPFFDELREPNARLPNGRPLPPLFNFK 173
            +RMP EA+DL SRL+Q+SP+L+ TALEA  HPFFDELR+PN RLPNGR LPPLFNFK
Sbjct:  325 KRMPPEAVDLVSRLLQYSPNLRSTALEALVHPFFDELRDPNTRLPNGRHLPPLFNFK 381          

HSP 2 Score: 21.557 bits (44), Expect = 2.399e-19
Identity = 7/17 (41.18%), Postives = 12/17 (70.59%), Query Frame = 1
Query:  199 ELVNKLIPDHGKRQLGL 249
            E++ KL+P H ++Q  L
Sbjct:  391 EMLVKLVPSHARKQCSL 407          
BLAST of CF832072 vs. ExPASy Swiss-Prot
Match: KSGT_BRANA (Shaggy-related protein kinase theta OS=Brassica napus PE=2 SV=2)

HSP 1 Score: 94.3597 bits (233), Expect = 5.021e-19
Identity = 45/62 (72.58%), Postives = 53/62 (85.48%), Query Frame = 3
Query:    3 QRMPSEAIDLASRLMQHSPSLQ*TALEACAHPFFDELREPNARLPNGRPLPPLFNF-KQELS 185
            +RMP EA+DL SRL+Q+SP+L+ TALEACAHPFFD+LR PN  LPNGR LPPLFNF  QEL+
Sbjct:  385 KRMPPEAVDLVSRLLQYSPNLRCTALEACAHPFFDDLRAPNVSLPNGRALPPLFNFTAQELA 446          
BLAST of CF832072 vs. ExPASy Swiss-Prot
Match: KSG3_ARATH (Shaggy-related protein kinase gamma OS=Arabidopsis thaliana GN=ASK3 PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 1.160e-18
Identity = 41/57 (71.93%), Postives = 50/57 (87.72%), Query Frame = 3
Query:    3 QRMPSEAIDLASRLMQHSPSLQ*TALEACAHPFFDELREPNARLPNGRPLPPLFNFK 173
            +RMP EA+DL SRL+Q+SP+L+  AL++  HPFFDELR+PNARLPNGR LPPLFNFK
Sbjct:  324 KRMPPEAVDLVSRLLQYSPNLRCAALDSLVHPFFDELRDPNARLPNGRFLPPLFNFK 380          

HSP 2 Score: 22.7126 bits (47), Expect = 1.160e-18
Identity = 7/14 (50.00%), Postives = 12/14 (85.71%), Query Frame = 1
Query:  199 ELVNKLIPDHGKRQ 240
            E+V KL+P+H ++Q
Sbjct:  390 EMVAKLVPEHARKQ 403          
The following BLAST results are available for this feature:
BLAST of CF832072 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt)
Total hits: 25
Match NameE-valueIdentityDescription
KSG7_ARATH4.757e-3283.61Shaggy-related protein kinase eta OS=Arabidopsis t... [more]
KSG6_ARATH4.547e-2988.52Shaggy-related protein kinase zeta OS=Arabidopsis ... [more]
KSG9_ARATH8.891e-2788.33Shaggy-related protein kinase iota OS=Arabidopsis ... [more]
KSG10_ARATH1.623e-2172.58Shaggy-related protein kinase kappa OS=Arabidopsis... [more]
KSG5_ARATH1.732e-2072.13Shaggy-related protein kinase epsilon OS=Arabidops... [more]
KSG4_ARATH3.477e-2074.19Shaggy-related protein kinase delta OS=Arabidopsis... [more]
KSG8_ARATH2.254e-1972.58Shaggy-related protein kinase theta OS=Arabidopsis... [more]
MSK2_MEDSA2.399e-1975.44Glycogen synthase kinase-3 homolog MsK-2 OS=Medica... [more]
KSGT_BRANA5.021e-1972.58Shaggy-related protein kinase theta OS=Brassica na... [more]
KSG3_ARATH1.160e-1871.93Shaggy-related protein kinase gamma OS=Arabidopsis... [more]

Pages

back to top
Libraries
Library NameType
Ruby Orange Ovary at Anthesis cDNA Librarycdna_library
Properties
Property NameValue
Genbank descriptionUCRCS02_01E07_r Ruby Orange Ovary at Anthesis cDNA Library Citrus sinensis cDNA clone CS_REa01E07, mRNA sequence.
Sequences
The following sequences are available for this feature:

EST sequence

>CF832072 ID=CF832072|Name=CF832072|organism=Citrus sinensis|type=EST|length=618bp
CACAACGGATGCCTTCTGAGGCTATTGATCTTGCTTCACGCCTGATGCAG
CATTCACCAAGTCTCCAATGAACAGCGCTAGAAGCATGTGCACATCCTTT
CTTTGATGAACTGCGTGAGCCAAATGCTCGCCTACCAAATGGCCGCCCAC
TGCCACCTCTCTTCAACTTTAAACAGGAATTATCGGTGGGCTTCACCAGA
GCTTGTTAATAAGTTGATACCAGACCATGGGAAACGGCAATTAGGTCTGA
ATTTCTTGCATCCAGCCGGGACATAGGTCTAGACAAGTAATATAGAAGTG
AAATCTACTTGGTGATGTGTAGCACAAAGGGAATTATATCCTTGTTCGTA
ACTGCCATGCATTGAGGCTTAATCAACATCAGATGTTGCTCGATCAGCAA
GCCTACATTCTCAGGCAGCTATGCTTTTCTTGGTGCCTTCTTTTTCTGCT
TTTCCATCCTCCTGTGTCTCCTCCCCACTTCGTCCCACCCCCCCTCCTCT
GTTAAAGTTCCCATTTGTTTATGTACATGTTTGATAGTAAAGATAGGTTA
AGTTGATAAGGTGGACTGATCAGACTGCTGTTAGTAGAGGAAAAACTGAG
GAAAAATGTATTTGTACC
back to top