CF832096
Overview
Libraries
Analyses
This EST is derived from or has results from the following analyses
Homology
BLAST of CF832096 vs. ExPASy Swiss-Prot
Match: RL291_ARATH (60S ribosomal protein L29-1 OS=Arabidopsis thaliana GN=RPL29A PE=1 SV=1) HSP 1 Score: 108.612 bits (270), Expect = 1.299e-23 Identity = 48/60 (80.00%), Postives = 55/60 (91.67%), Query Frame = 3 Query: 45 LAKSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKQGGESAAEE 224 +AKSKNHTAHNQS KAHKNGIKKP++HRHT T+GMDPKFLRNQRYARKHN + GE+A+ E Sbjct: 1 MAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARKHNVKAGENASAE 60
BLAST of CF832096 vs. ExPASy Swiss-Prot
Match: RL292_ARATH (60S ribosomal protein L29-2 OS=Arabidopsis thaliana GN=RPL29B PE=2 SV=2) HSP 1 Score: 107.842 bits (268), Expect = 2.216e-23 Identity = 48/60 (80.00%), Postives = 54/60 (90.00%), Query Frame = 3 Query: 45 LAKSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKQGGESAAEE 224 +AKSKNHTAHNQS KAHKNGIKKP++HRHT T+GMDPKFLRNQRYARKHN + GE+A E Sbjct: 1 MAKSKNHTAHNQSAKAHKNGIKKPRRHRHTPTRGMDPKFLRNQRYARKHNVKSGENAGVE 60
BLAST of CF832096 vs. ExPASy Swiss-Prot
Match: RL29_RAT (60S ribosomal protein L29 OS=Rattus norvegicus GN=Rpl29 PE=1 SV=3) HSP 1 Score: 86.2705 bits (212), Expect = 6.905e-17 Identity = 37/53 (69.81%), Postives = 45/53 (84.91%), Query Frame = 3 Query: 45 LAKSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKQG 203 +AKSKNHT HNQS K H+NGIKKP+ R+ S KG+DPKFLRN R+A+KHNK+G Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKG 53
BLAST of CF832096 vs. ExPASy Swiss-Prot
Match: RL29_PIG (60S ribosomal protein L29 OS=Sus scrofa GN=RPL29 PE=2 SV=4) HSP 1 Score: 86.2705 bits (212), Expect = 6.905e-17 Identity = 37/53 (69.81%), Postives = 45/53 (84.91%), Query Frame = 3 Query: 45 LAKSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKQG 203 +AKSKNHT HNQS K H+NGIKKP+ R+ S KG+DPKFLRN R+A+KHNK+G Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKG 53
BLAST of CF832096 vs. ExPASy Swiss-Prot
Match: RL29_MOUSE (60S ribosomal protein L29 OS=Mus musculus GN=Rpl29 PE=2 SV=2) HSP 1 Score: 86.2705 bits (212), Expect = 6.905e-17 Identity = 37/53 (69.81%), Postives = 45/53 (84.91%), Query Frame = 3 Query: 45 LAKSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKQG 203 +AKSKNHT HNQS K H+NGIKKP+ R+ S KG+DPKFLRN R+A+KHNK+G Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKG 53
BLAST of CF832096 vs. ExPASy Swiss-Prot
Match: RL29_MACFA (60S ribosomal protein L29 OS=Macaca fascicularis GN=RPL29 PE=2 SV=3) HSP 1 Score: 86.2705 bits (212), Expect = 6.905e-17 Identity = 37/53 (69.81%), Postives = 45/53 (84.91%), Query Frame = 3 Query: 45 LAKSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKQG 203 +AKSKNHT HNQS K H+NGIKKP+ R+ S KG+DPKFLRN R+A+KHNK+G Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKG 53
BLAST of CF832096 vs. ExPASy Swiss-Prot
Match: RL29_HUMAN (60S ribosomal protein L29 OS=Homo sapiens GN=RPL29 PE=1 SV=2) HSP 1 Score: 86.2705 bits (212), Expect = 6.905e-17 Identity = 37/53 (69.81%), Postives = 45/53 (84.91%), Query Frame = 3 Query: 45 LAKSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKQG 203 +AKSKNHT HNQS K H+NGIKKP+ R+ S KG+DPKFLRN R+A+KHNK+G Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKG 53
BLAST of CF832096 vs. ExPASy Swiss-Prot
Match: RL29_BOVIN (60S ribosomal protein L29 OS=Bos taurus GN=RPL29 PE=2 SV=3) HSP 1 Score: 86.2705 bits (212), Expect = 6.905e-17 Identity = 37/53 (69.81%), Postives = 45/53 (84.91%), Query Frame = 3 Query: 45 LAKSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKQG 203 +AKSKNHT HNQS K H+NGIKKP+ R+ S KG+DPKFLRN R+A+KHNK+G Sbjct: 1 MAKSKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKG 53
BLAST of CF832096 vs. ExPASy Swiss-Prot
Match: RL29_DROME (60S ribosomal protein L29 OS=Drosophila melanogaster GN=RpL29 PE=1 SV=1) HSP 1 Score: 78.9518 bits (193), Expect = 1.102e-14 Identity = 38/56 (67.86%), Postives = 43/56 (76.79%), Query Frame = 3 Query: 45 LAKSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYARKHNKQGGES 212 +AKSKNHT HNQ+ KAH+NGIK+P + RH ST GMD KFL NQRYARK N ES Sbjct: 1 MAKSKNHTNHNQNKKAHRNGIKRPLRKRHESTLGMDVKFLINQRYARKGNLSREES 56
BLAST of CF832096 vs. ExPASy Swiss-Prot
Match: RL29_YEAST (60S ribosomal protein L29 OS=Saccharomyces cerevisiae GN=RPL29 PE=1 SV=3) HSP 1 Score: 73.1738 bits (178), Expect = 6.049e-13 Identity = 31/46 (67.39%), Postives = 40/46 (86.96%), Query Frame = 3 Query: 45 LAKSKNHTAHNQSYKAHKNGIKKPKKHRHTSTKGMDPKFLRNQRYA 182 +AKSKNHTAHNQ+ KAH+NGIKKPK +++ S KG+DPKF RN ++A Sbjct: 1 MAKSKNHTAHNQTRKAHRNGIKKPKTYKYPSLKGVDPKFRRNHKHA 46 The following BLAST results are available for this feature:
BLAST of CF832096 vs. ExPASy Swiss-Prot
Analysis Date: 2010-05-10 (BLAST: Citrus ESTs to SwissProt) Total hits: 11
Pagesback to topProperties
Sequences
The
following sequences are available for this feature:
EST sequence >CF832096 ID=CF832096; Name=CF832096; organism=Citrus sinensis; type=EST; length=463bpback to top |